KEGG   Dendrobium catenatum: 110109966Help
Entry
110109966         CDS       T05027                                 

Definition
(RefSeq) glutathione S-transferase 2 isoform X3
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
dct  Dendrobium catenatum
Pathway
dct00350  Tyrosine metabolism
dct01100  Metabolic pathways
Module
dct_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:dct00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    110109966
Enzymes [BR:dct01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     110109966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 110109966
NCBI-ProteinID: XP_020696867
Position
Unknown
AA seq 217 aa AA seqDB search
MADSAKLQLYSYWRSSSSHRVRIVLNLKGLEYEYKPVNLLKNEQSTPEFAKLNPLKYVPV
LVDGDAVIADSFVITLYLEDKYPEHPLLPKDLKNKALNLQVASIVGSSIQPLHNLGVLNY
IEGKLNSNEKVAWAQYHINYGFEALEKLLKDVAGKFATSDEAQLADAFLAPQILTASRFE
IDMGRYPTLARLKEAYDEHPAFIAALPTNQPDAPTSS
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcggattcggcgaagctccaactctactcatactggcggagctcttcctcacatcgt
gtccgcatcgtactgaatcttaaagggttggagtatgagtacaagcccgttaacctttta
aagaatgagcagtcgactcctgagtttgctaagttgaatccacttaaatacgttccggtg
ctggtagatggggatgccgtgatagccgactcttttgtgattacattgtatttggaagac
aaatatcccgagcatcctctcctgcccaaggatctgaagaataaagcactcaatcttcag
gtagctagtattgtggggtccagcattcaacctcttcacaacctgggtgttttgaattat
attgaggggaaacttaattctaatgagaaagttgcttgggctcagtatcacatcaattat
ggctttgaagcccttgagaaattgttaaaagatgttgccggaaagtttgccacaagtgat
gaagcccaactggctgatgcatttctagctcctcagatccttacagcatcaaggttcgag
attgacatgggtcgctacccaacactcgccaggctcaaggaagcttatgatgagcatcct
gctttcattgctgctcttccgacaaaccaaccggatgcacctacgtcatcttag

DBGET integrated database retrieval system