KEGG   Dendrobium catenatum: 110112100Help
Entry
110112100         CDS       T05027                                 

Definition
(RefSeq) glucomannan 4-beta-mannosyltransferase 1
  KO
K13680  beta-mannan synthase [EC:2.4.1.32]
Organism
dct  Dendrobium catenatum
Brite
KEGG Orthology (KO) [BR:dct00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dct01003]
    110112100
Enzymes [BR:dct01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.32  glucomannan 4-beta-mannosyltransferase
     110112100
Glycosyltransferases [BR:dct01003]
 Polysaccharide
  Structural polysaccharide
   110112100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 110112100
NCBI-ProteinID: XP_020699856
Position
Unknown
AA seq 497 aa AA seqDB search
MVVLPAIKVMIWLCLAMSLMLVVEKLSMAVTVLCVKLYRPLRPHRVYRWEPLPAIAGDDD
PELGSYVYPAVLVQIPMFNEREVYHLSIGAACALTWPSDRLIIQVLDDSTDKTIRDLVQA
ECERWTKKGVSIHYISRDNRNGYKSGALREAMDFDYVKTCDFVAIFDADHQPPSDFLMQT
IPFLIHNPDLALVQARWKFVNADECLMTRIQEMSLNYHFVVEQESGSSTIAFFGFNGTAG
VWRISAVDEAKGWKDRTTVEDMDLAVRACLEGWKFVYVGDLNVRSELPSTYKAYRYQQHR
WACGPACLFRKMASEIMRAKKASIWRKLFLIYNFFFARRIVSHIVTFFFYCVIIPLSVFF
PEVKVPVWGVVLIPSIITFLNAIGTPSSMHLMLIWIFFENVMSLHRCKAVFIGLLEAGRV
NEWIVTEKLGNMLQMKQMPSVAASKFWERFHFMEIGVGIWLLICAWQDFKYRTEQYYIFI
FPSSLAFIIMGCGYVGR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgcttccggcgattaaggtcatgatttggctttgcttggcaatgtcgctgatg
ctcgtcgtggagaagttgtccatggccgtcaccgtcttgtgcgttaagctctaccggcca
ctaaggccgcaccgagtctacaggtgggagccacttccagcgatcgccggagacgatgat
cccgaacttggctcttatgtttatcccgctgtccttgtccagattccaatgttcaatgaa
cgagaggtttatcatttatccattggagcagcatgcgcactcacatggccatccgatcgc
ctaataatacaagttcttgatgattcaactgacaaaacaattagggatttagtacaagcg
gaatgtgaaagatggactaaaaagggagtgagcatacactacatttcaagggacaataga
aatggatataaatctggcgctctaagagaggcaatggattttgattatgtcaagacctgt
gattttgttgctatttttgatgctgatcaccaaccaccctccgattttctaatgcaaacc
atcccttttcttattcataatccggatcttgctctggtccaagctcgttggaaattcgta
aatgctgatgaatgcttgatgacgaggattcaagaaatgtccttaaattatcatttcgta
gtggagcaggagtcgggttcttcgacgatagcattttttggatttaacggtactgctggt
gtttggcgaatctctgctgttgatgaagctaaaggatggaaagatcgaacaactgtggag
gatatggatctagcagtcagagcatgtttggagggctggaaatttgtctatgttggtgac
cttaacgttagaagtgaactgccaagcacttataaagcatatcgctatcaacagcatcgt
tgggcctgcggacctgcatgtttgttcagaaaaatggcctctgaaattatgagagccaag
aaagcatcaatatggaggaagttgtttttgatctacaacttctttttcgcaagaagaatc
gtgtctcacattgttaccttcttcttctactgtgtgatcataccgttatctgttttcttt
cctgaagtgaaagttccagtttggggtgtggttcttattccatcgataattacattcttg
aatgccatcgggacgccaagctccatgcatttgatgcttatatggatatttttcgagaat
gtaatgtcattgcacagatgcaaggcggtcttcatcggtctattggaagctgggagggtg
aatgaatggattgttactgagaaactcggcaacatgttgcagatgaagcaaatgccctct
gttgcggccagcaaattctgggagagatttcatttcatggagataggggttggaatatgg
ctattgatctgcgcatggcaggacttcaagtacagaacagagcagtactacatatttatc
ttcccttcatcactagcatttattatcatgggatgcggctacgttggaagatga

DBGET integrated database retrieval system