KEGG   Dendrobium catenatum: 36482845Help
Entry
36482845          CDS       T05027                                 

Gene name
rpl22, DDH38_pgp030
Definition
(RefSeq) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dct  Dendrobium catenatum
Pathway
dct03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dct00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    36482845 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dct03011]
    36482845 (rpl22)
Ribosome [BR:dct03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    36482845 (rpl22)
  Bacteria
    36482845 (rpl22)
  Archaea
    36482845 (rpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 36482845
NCBI-ProteinID: YP_009472304
Position
CP
AA seq 121 aa AA seqDB search
MIKNENSDREAKVLAQHICMSVFKARRVIDQIRGRSYEETLMILELMPYRASYPILKLVY
SAAANASHNMGLNEADLFISKAEVNRGAIVKKFRPRARGRSYLIKKTTCHIKIFLKEKSK
F
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaacgaaaattcggatagagaagcaaaagtgttagctcaacatatatgtatg
tctgttttcaaagcacgaagagtaattgatcagattcgcggacgttcttatgaagaaaca
ctcatgatattggaactaatgccctatagggcatcttatccaattttaaaattagtttat
tctgcagcagcaaatgctagtcataatatgggtttgaatgaagctgatttatttattagt
aaagctgaagtcaatagaggtgctattgtgaaaaagttcagaccccgggctcgagggcgt
agttatctgataaaaaaaaccacttgtcatataaagatttttttaaaagaaaaatcgaaa
ttttag

DBGET integrated database retrieval system