KEGG   Dickeya paradisiaca: Dd703_0024Help
Entry
Dd703_0024        CDS       T00927                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dda  Dickeya paradisiaca
Pathway
dda00010  Glycolysis / Gluconeogenesis
dda00052  Galactose metabolism
dda00500  Starch and sucrose metabolism
dda00520  Amino sugar and nucleotide sugar metabolism
dda00521  Streptomycin biosynthesis
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
Module
dda_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dda_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd703_0024
   00052 Galactose metabolism
    Dd703_0024
   00500 Starch and sucrose metabolism
    Dd703_0024
   00520 Amino sugar and nucleotide sugar metabolism
    Dd703_0024
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dd703_0024
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dd703_0024
Enzymes [BR:dda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dd703_0024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACS83843
UniProt: C6C5N0
Position
29573..30541
Genome map
AA seq 322 aa AA seqDB search
MYQYALVGDVGGTNARLALCDLTNGNLSHGKQYSVLEHDSLESVIRLFLGEHAALAVGSG
CIAIACPITGDWVEMTNHNWAFSIAAVKQSLGFSHLEVINDFTAVSMAIPALAPDDVIQL
GGAAPLAGKPIAVYGAGTGLGVGHLLPVGDQWVSLPGEGGHVDFASNSEEEDLLLQVLRQ
ELGHVSAERVLSGPGLVNIYRAIVKSDDRVPEALTPQTISERALAHSDVDCLRALSLFCV
LMGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFRNSGFRAAFEDKGRFRDYLADIPAYLI
THPQPGLLGAGAYLRQALGQTL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaatatgcgctggtcggcgatgtcggcggaaccaatgcccgccttgctctctgt
gatctgacgaatggcaatttgtcgcacggtaagcagtattcggtgttagagcacgatagc
ctggaaagcgtcatccggttgtttcttggcgaacacgccgcactcgccgtcggcagtggc
tgtatcgccatcgcctgcccgattaccggcgattgggtggagatgaccaatcataactgg
gccttttcgattgccgccgtgaagcagagcctcggtttttcccatctggaagtgattaac
gattttaccgccgtcagcatggcgattccggcgctggcgccggacgatgtgattcagttg
ggcggtgcagcgccgctggcgggcaagcctatcgcggtgtatggcgcgggtaccggtctg
ggcgtcggtcatttgctgccggtcggcgaccagtgggtcagcctgccgggcgaggggggg
catgtggatttcgcctctaacagcgaagaagaagatctgttgttgcaggtgctgcgtcag
gaactggggcacgtttccgctgagcgggtgttgtccgggccgggattggtcaatatttat
cgcgccatcgtcaaatcggatgatcgcgtgccggaggcgctaacgccgcagacgatttcc
gagcgggcgctggcccacagcgatgtggattgcctgcgcgcactgtcgctgttttgtgtg
ttgatggggcggttcggcggcaatctggcgctgacgctgggcaccttcggcggcgtctat
atcgccggcggcattgtgccgcgttttcttgagtttttccgtaattccggctttcgggcg
gcgtttgaagacaaaggccgttttcgggactatctggcggatattccggcgtatctgata
acccacccgcagcccggtctgctgggcgccggcgcgtatttgcgtcaggcgttgggacag
acgttgtaa

DBGET integrated database retrieval system