KEGG   Dickeya paradisiaca: Dd703_0049Help
Entry
Dd703_0049        CDS       T00927                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dda  Dickeya paradisiaca
Pathway
dda00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dd703_0049
Enzymes [BR:dda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Dd703_0049
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Dd703_0049
    1.1.1.-  
     Dd703_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc F420_oxidored Shikimate_DH 2-Hacid_dh_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACS83868
UniProt: C6C5Q5
Position
59473..60525
Genome map
AA seq 350 aa AA seqDB search
MKALRWHGQKDIRIDDVAEAQAGPGRVKIKVKWCGICGTDLHEYLAGPIFIPVEHPHPLT
GEKAPVTLGHEFCGEIVEVGAGVSDYHVGDRVTVEPILFDPNSKASRQGLYNLCDKMGFY
GLAGMGGGFSEYASVPASIIHRLPDSVSYEQGALTEPAAVAVHAVRESRFQMGDKAAVFG
AGPIGLLVVEALKAAGAQEIYVVELSPQRREKAASLGAIVIDPSATDAVQEIVARTDGGV
DVAYEVTGVAPVLQQSIDCVRIQGETMIVSVWEKAAPIYPNQILFKERHVTGIIGYRNVF
PATLALMEKGYFKPKDFVTRQIALDDVIEQGFNTLIADKSQVKILVSPEK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgttaagatggcacggtcagaaagacattcgtatcgatgacgttgcagaagct
caggcagggccgggacgggtcaaaatcaaggtgaaatggtgcggtatctgcggcaccgat
ctgcacgaataccttgccgggccgatctttatcccggtcgaacacccccatccgctgacc
ggtgaaaaagcgcccgtgacgctgggccatgagttctgcggcgaaatcgtggaagtcggc
gccggtgtcagcgattatcacgtcggggatcgggtgacggtcgagccgattctgttcgat
cccaactccaaagccagccgtcaggggctttacaatctgtgcgacaaaatgggcttttac
ggtctggctgggatgggcggcggtttttccgagtatgcgtcggtgccggcatccatcatt
catcgtctgcccgattcggtgagctatgagcaaggcgcgctcaccgagcctgcggcggtt
gcggtacatgcggtgcgggaaagccgtttccagatgggcgacaaggccgccgtgtttggc
gccgggccgatcggattgctggttgtcgaagcgcttaaggctgccggcgcgcaggagatc
tatgtcgtcgagctgtcgccgcagcgccgggaaaaggcggcctcgttgggcgccatcgtt
atcgacccttccgcgacggatgcggtacaggagattgtggcgcgtaccgacggcggcgtc
gatgtggcctatgaagtgaccggcgtggcgccggtattgcagcagagtatcgactgcgtg
cgtattcagggcgaaaccatgatcgtcagcgtgtgggaaaaggctgcgccgatttacccc
aaccagatactgtttaaagaacggcatgtgacggggattatcggttatcgcaatgtgttc
ccggctacgctggcgctgatggaaaaaggttatttcaaaccgaaagacttcgtgacgcgc
cagatcgcgctcgacgatgtgattgagcaggggttcaacacgttgattgccgataagtcc
caggtgaagattctggtctcccccgagaagtga

DBGET integrated database retrieval system