KEGG   Dickeya paradisiaca: Dd703_0354Help
Entry
Dd703_0354        CDS       T00927                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
dda  Dickeya paradisiaca
Pathway
dda00340  Histidine metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dda00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Dd703_0354
Enzymes [BR:dda01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     Dd703_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ACS84168
UniProt: C6C823
Position
404444..405790
Genome map
AA seq 448 aa AA seqDB search
MKLDKTLMIPPEGIPDAQRQDILRAYMANMHERRSHFVGFQTNQSGSFQEDLRPLLQMNL
LNLGDNTEPGAYQVNSKAFELAVLDYYARLWNMPLSAWGYLTAMGSTEGNLFALWNAREY
LCGAATAPTTPVVLYSDRGHYSLAKAAQLLQLPTPADIGPTLGRCPVNDGVWSPTVGCDA
AGRVKVDELMRLTTFFYRHGRPVILCLTCGTTFSGACDDWPQITEHLRRLLPPNTEQQRH
YWLHIDGALSANYLSFWPEPDGRHLAVHGKASALHSVCCSPYKWLGMSWPCGVVMLSEAF
QVTARARPDYIGSRDATLSGSRPGLTAVVLWEMLSRLGEQGQQALIRHCFAVREYAHSQL
QQLFARLDPMGVRLCLYPLVCGSLMVQFTAPSPAVIDYFSLSTEQRMWRGQPTQVCHLVL
LPHCRRALIDELVRRLEQPGAFTSVGGQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggataaaacactcatgatccctcctgaagggatcccggatgcgcaacggcaa
gacatcctgcgggcctatatggccaacatgcatgaacgacggagccacttcgtcggcttt
cagactaatcagtccggcagttttcaggaggatctgcgcccgttgctgcaaatgaatttg
ctgaatctgggtgataacacggagcctggcgcctatcaggtgaacagtaaagccttcgaa
ctggcggttctggactactatgcccgcctgtggaacatgccgttgagtgcctggggatac
ctgaccgcgatggggtccaccgaaggcaacctgtttgcgttatggaatgcgcgtgaatat
ctctgcggcgcggcgacggcgcccacgacgccggtggtgctctattctgatcgcggccat
tactcgctggccaaagccgcacaactcttacagttgccgacccccgccgatatcgggccg
acgttgggacgctgcccggtgaacgacggcgtgtggtcgcccacggtcgggtgcgacgcc
gccgggcgcgtcaaggtagacgaactgatgcgactgacgacgtttttttatcgccacggg
cggccggtgatcctctgcctgacctgcggtaccacgtttagcggcgcctgcgatgactgg
ccgcaaattacggaacacctgcgtcggttgttgccgccgaatacggaacaacagcggcac
tactggttacatatcgacggcgcgctgtccgcgaattatttgtcgttttggccggaaccg
gatggccgacatctggcggtgcacggcaaagcgtcagcgttgcactccgtctgttgtagc
ccctacaaatggctgggcatgtcgtggccgtgcggggtggtcatgttatcggaagcgttt
caggtaacggcgcgcgcgcgaccggactacatcggcagccgggacgccaccttgtccggc
tcccgccccgggttgaccgccgtcgtgctgtgggaaatgttgtcccgtctgggtgagcag
gggcaacaggcgttaatccgccactgtttcgcggtgagggaatatgcccacagccaacta
cagcagctgtttgcccggctggatcctatgggcgtgcgtctctgtctgtatcccctggtc
tgcggttcactgatggtgcagtttacggcgccgtcgccggcggttatcgactacttctcg
ctgtcgaccgaacagcggatgtggcggggacagccgacgcaggtgtgccacctggtgcta
ttgccccattgtcgtcgtgctctgattgatgagctggtacgcaggctggaacaacccggg
gcatttacatccgttggggggcagtga

DBGET integrated database retrieval system