KEGG   Dickeya paradisiaca: Dd703_0601Help
Entry
Dd703_0601        CDS       T00927                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
dda  Dickeya paradisiaca
Brite
KEGG Orthology (KO) [BR:dda00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Dd703_0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACS84412
UniProt: C6C9G1
Position
complement(676109..676486)
Genome map
AA seq 125 aa AA seqDB search
MINAPRVCIQVQSFYVEAQSQPDEDRFIFAYTITIRNLGRHDIKLLNRYWIITNGNGKQT
EVQGEGVVGLQPLILPGNDFQYTSGAILETPMGTMEGHYQMIDHQGEAFQVAIPVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaacgcgccccgagtttgcatacaggttcaaagcttctacgtggaagcgcaatct
caaccagatgaagatcgtttcatttttgcctacaccattaccatccgtaatctggggcgt
cacgacatcaaactgctgaaccgttattggatcattaccaacggcaacggcaagcagacc
gaagtacagggtgaaggcgtggtcggcctgcaaccgctgattctgccgggcaatgatttt
cagtacaccagcggcgcgattctggaaacgccgatgggaaccatggaaggccactaccag
atgatcgatcatcagggcgaggcgtttcaggttgctataccggttttccgtctggcaatc
ccttcattaatacattaa

DBGET integrated database retrieval system