KEGG   Dickeya paradisiaca: Dd703_1141Help
Entry
Dd703_1141        CDS       T00927                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dda  Dickeya paradisiaca
Pathway
dda00020  Citrate cycle (TCA cycle)
dda00190  Oxidative phosphorylation
dda00650  Butanoate metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
Module
dda_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dda_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dda_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dd703_1141
   00650 Butanoate metabolism
    Dd703_1141
  Energy metabolism
   00190 Oxidative phosphorylation
    Dd703_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACS84946
UniProt: C6CCD5
Position
1305946..1306293
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVIVLYVLYIVGFIASAGGITYEIWRGFFAMHLTKVF
TLLTLISILVHAWIGMWQVLTDYIKPLAIRLVLQLAIVVVLVVYVIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttccgctttgggacgcaatggcgtacacgactggttgctacttcgc
gcttccgccatcgtcatcgtactgtatgtcctttatatcgtcggttttattgcgagcgcc
ggcggtattacttatgaaatctggcgtggtttttttgccatgcatctcaccaaagtgttc
accctgttgacgctgatttctattctggttcatgcctggataggtatgtggcaggtactg
actgactacataaaaccgctggcaattcggctggtattacagctggcgattgtggtggta
ttggtggtgtatgtcatttatggaacagtcgtggtgtggggtgcatga

DBGET integrated database retrieval system