KEGG   Dickeya paradisiaca: Dd703_1261Help
Entry
Dd703_1261        CDS       T00927                                 

Definition
(GenBank) glycoside hydrolase family 2 TIM barrel
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
dda  Dickeya paradisiaca
Pathway
dda00052  Galactose metabolism
dda00511  Other glycan degradation
dda00600  Sphingolipid metabolism
dda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dd703_1261
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dd703_1261
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dd703_1261
Enzymes [BR:dda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dd703_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Bgal_small_N DUF4981 Glyco_hydro_2
Motif
Other DBs
NCBI-ProteinID: ACS85063
UniProt: C6CD22
Position
complement(1439486..1442584)
Genome map
AA seq 1032 aa AA seqDB search
MSITATPPTLAQILARRDWENPACSQVNRLDAHPPFSSWRNLQHARDDEPSRRRQPLNGE
WVFSYFPRPEAVPESWLTQDLPQADRTIVPSNWQLSGYDAPIYTNVKYPIPVNPPLVPAE
NPTGCYSLTFKVDDSWRQHGQTRIIFDGVNSAFHLWCNGCWIGYSQDSRLPAEFDLSNAL
QEGDNRLAVMVLRWSDGTYLEDQDMWRMSGIFRDVWLLHKPTTQLRDIQLTTPLSRDYTH
GTLCVQASASLLPETAANWRLHVQLWRHGQLEAEAIAPFGSAPIDERGNYHDRVDIQLDI
DNPALWSAETPHLYRVVAALEYADGMLVEAEAYDVGFREVSISNGRLKLNGKPLLIRGVN
RHEHHPEHGQVMDEATMLQDILLMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYVVDEANI
ETHGMQPMNRLSDDPRWLPAMAERVTRMVQRDRNHPCIIIWSLGNESGYGRAHSALYQWV
KQQDPTRPVQYEGGGADTPATDILCPMYARVDQDQPFPAVPKWAIKKWIGLPDESRPLIL
CEYAHAMGNSFGGFARYWQAFRQYPRLQGGFVWDWVDQALTRYDRHPPHWAYGGDFGDTP
NDRQFCLNGLVFPDRTPHPALYEAQRAQQFFQFESLSAEPLTIAVTSEYLFRASDNEILQ
WRIMQDNLTLAEGRVELSLPPEGRQIITLLDTLPTVRHPAAMWLNLDVIQPTATAWSPAG
HCCAWDQWALPAPMPTPALMPSTGAAPRLSSTEEAVEITHGDQSWTFHRHSGLLTHWQQD
HRQRLLSPLRDNLTRAPLDNDIGISEVDRIDPHAWVERWKLAGLYQYETDCLEIRADALG
DGVVVNTTHAGRYQQQTLFVSRKQWRIDNQGRLSVSVDVEVSPHLPPLARVGLSCQLAEV
FPQVSWRGLGPHENYPDRRLSARHGRWQLPLEAMHTPYIFPSENGLRCDTEELNYGDWTI
DGDFHFGIGRYSQQQLMNCSHHHLLQPETGVWLNLDGFHMGVGGDDSWSPSVAPDFLLTR
PRYHYQLRITLG
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaccgccacgccgcccacactggcacaaattctcgccagacgggactgggaa
aaccccgcctgcagccaggttaaccggttggatgcccacccgccattttccagttggcgc
aatctgcagcacgcccgggacgatgaaccttcccgccgacgccagccgctgaatggcgaa
tgggtattcagctattttccccgtccggaggcggtgccggaaagttggctgacacaggat
ttaccgcaggcggatcgcaccatcgtaccgtccaactggcaactatccggctacgacgcc
cccatttataccaacgtgaaataccccatcccggtcaacccacccttggtaccggcagaa
aatcccaccggatgttattcgctcacattcaaggttgatgatagctggcgacaacatggg
caaacacgcatcatttttgacggtgtgaattcggcttttcatttgtggtgtaacggctgc
tggatcggctactcgcaggacagtcgcctgcccgccgaattcgacctcagcaatgccttg
caggaaggagataaccggttggcggtcatggtgctgcgctggtcggacggcacctatctg
gaagatcaggatatgtggcgcatgagcggcatcttccgcgatgtgtggctgttgcataaa
ccgacgacgcaactgcgcgacattcagctcaccaccccgctcagccgggattatacgcac
ggcacgctatgcgttcaggccagcgccagcctgttgccggaaacggcggccaactggcgt
ctgcatgtgcagctctggcgccatggtcagcttgaggcggaagcgatcgcgcccttcggc
agcgcccctatcgatgaacggggcaactatcacgatcgcgtcgacattcaactagacatc
gacaaccccgcgctgtggagcgccgaaacgccgcacctctatcgcgtggtggcggcgctg
gaatatgccgacggcatgctggtggaagcggaagcttacgacgtcgggtttcgcgaagtg
agcatcagcaacgggcggttgaaactcaacggcaaaccgctgctgatccgcggcgtcaac
cgccatgagcaccaccccgagcacggtcaggtgatggatgaagcaaccatgctgcaagat
atcttattgatgaagcagcataattttaatgcagtacgctgttcgcactatcccaaccat
ccgttgtggtaccgcctgtgcgaccgctacggcctgtacgtggtggatgaagccaatatc
gaaacccatggcatgcagccaatgaaccgattgtctgacgacccgcgctggctgcccgcg
atggcggagcgcgtcacccgcatggttcagcgcgatcgcaaccatccgtgcatcatcatt
tggtcgttgggcaacgaatccggctatggacgtgcgcacagtgcgctctatcagtgggtc
aaacagcaagatcctacccgcccggtgcagtacgaaggcggcggcgccgatacccccgcc
accgatattctctgcccgatgtacgcccgggtcgatcaggatcagccgttccccgccgtg
ccgaaatgggccatcaaaaagtggatcggcctgccggacgaatcgcgtccgctgatcctg
tgcgaatacgctcatgcgatgggcaacagcttcggcggattcgcccgctactggcaggcg
tttcgccagtacccccggctgcagggcgggttcgtctgggattgggtagatcaggcgctg
acccgctacgatcgccatccgccgcactgggcttacggcggcgatttcggcgacacgccc
aacgatcgccagttctgcctcaacgggctggtgttcccggatcgcaccccgcatccggca
ttgtacgaagcccaacgcgcgcagcaatttttccagttcgagtctctttccgccgagccg
ctgaccatcgccgtcaccagcgaatacctgtttcgcgccagcgataacgaaatcctgcaa
tggcgcatcatgcaagacaacctgacgcttgccgaaggccgtgttgaactgtcgctgccg
ccggaaggcaggcaaatcatcacactgctcgacacactaccgacggttcgccaccccgcc
gccatgtggctgaatctggacgtcatccaacccacggcgacggcatggtcgcccgccggc
cattgctgcgcctgggatcaatgggcactgccggcccccatgccgacgccggcgcttatg
ccgtcgacaggcgccgcgccgcgattgtcctccaccgaggaggccgttgagatcacgcac
ggcgaccagagttggacgttccatcgtcatagcggattactcacgcattggcagcaagac
catcggcaacgcctgcttagcccgctgcgggataacctcacccgcgccccgctggacaac
gatatcggcatcagcgaggtagatcgaatcgacccacatgcctgggtggaacgttggaaa
ctggcgggattgtaccagtacgaaaccgactgcctcgagattcgggccgacgcattaggc
gacggcgtggtagtcaacaccacgcacgcgggccgctatcagcaacagacgctgtttgtc
agccgcaagcagtggcgcatcgataatcaggggcggttgagcgtgagcgtggatgtcgag
gtttcgccgcacctgccgccgttggctcgcgtcgggctgagttgccagttggcagaggta
tttccacaggtcagctggcgcgggctggggccgcatgaaaattatccggacagacgtctc
tccgcgcgtcacggccgctggcagttgccgctggaggccatgcatacgccttatattttc
ccatccgaaaacggcctgcgctgcgatacggaagagttgaactacggtgattggactatc
gatggtgatttccacttcggcatcggccggtatagccaacagcagttgatgaactgcagc
caccaccatctgctacaaccggaaaccggcgtctggctcaatctggacggcttccatatg
ggggtcggcggcgatgattcctggagcccgagcgtagcccccgactttctgctgacccgc
ccgcgctaccactaccagttgcggatcacactcggttaa

DBGET integrated database retrieval system