KEGG   Dickeya paradisiaca: Dd703_1373Help
Entry
Dd703_1373        CDS       T00927                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dda  Dickeya paradisiaca
Pathway
dda00071  Fatty acid degradation
dda00072  Synthesis and degradation of ketone bodies
dda00280  Valine, leucine and isoleucine degradation
dda00310  Lysine degradation
dda00362  Benzoate degradation
dda00380  Tryptophan metabolism
dda00620  Pyruvate metabolism
dda00630  Glyoxylate and dicarboxylate metabolism
dda00640  Propanoate metabolism
dda00650  Butanoate metabolism
dda00900  Terpenoid backbone biosynthesis
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
dda01212  Fatty acid metabolism
dda02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dd703_1373
   00630 Glyoxylate and dicarboxylate metabolism
    Dd703_1373
   00640 Propanoate metabolism
    Dd703_1373
   00650 Butanoate metabolism
    Dd703_1373
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dd703_1373
   00072 Synthesis and degradation of ketone bodies
    Dd703_1373
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dd703_1373
   00310 Lysine degradation
    Dd703_1373
   00380 Tryptophan metabolism
    Dd703_1373
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dd703_1373
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dd703_1373
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dd703_1373
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dda04147]
    Dd703_1373
Enzymes [BR:dda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dd703_1373
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd703_1373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ACS85175
UniProt: C6CDQ8
Position
1574045..1575214
Genome map
AA seq 389 aa AA seqDB search
MKEAVIVAAARTPIGRCRGMLAPVPAHQLGALAVREAVLRAGIAPEQIDDVIFANLMNHE
INNMGRMVALEAGLPVTVPGITLDRQCAASLNALAYGAIQIMAGFADVIVAGGVESDSRR
TWMLEKTDTAYAVQPPRFVDIHTTPDRFGNPPMGITAENVAAKYGFSRRQLDEFAQRSHQ
RAAGALQAGRFEEQIVPVMLTDKKGRESWVQQDEAIRPECSLEGLAALRPSFLPDGVVTA
GNSSPMSDGAGAVVMMERELAERSGREILAVFRGYAAAGVEPGLMGLGPIPATAKLLKQA
GLNVGDIDLWELNEAFAAQSLACIREIGMDPDRVNPNGGAIAMGHPLAGTGAILATKTVY
DMRRRNLHNAVITFCVGGGQGVAVLLTRE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagcagtgattgtagcggcggcacgcacgccgattggccgctgccggggaatg
ctggccccggtgccggcacaccagttgggggctctggcggtccgcgaagcggtacttcgc
gccgggatcgcgcccgaacagatcgacgatgtcatcttcgccaatctcatgaatcacgaa
atcaacaacatggggcgcatggtggcgctggaggccgggctgccggtgacggtgccgggc
atcacgctggatcgccagtgcgccgcctcgctcaatgcgctggcgtatggcgccatccag
atcatggcggggttcgccgacgtgattgtcgccggcggggtggaaagcgactcccggcga
acctggatgctggagaaaaccgataccgcctacgccgttcagccgccgcgcttcgtggat
atccacaccacgccggatcggtttggtaatccgccgatggggatcaccgcggaaaacgtg
gcggcgaaatacgggtttagccgtcggcaactggatgagtttgcgcagcgcagccatcaa
cgggccgccggcgcgttgcaggcaggaaggttcgaggaacagatcgtgccggtgatgctg
accgacaagaaagggcgggaaagctgggtacagcaggatgaagccatccgccccgagtgt
tcgctggaagggctggcggcgttgcggccgagtttcctgcccgacggcgtggtgacggcg
ggcaacagttcgccgatgagcgacggcgccggcgcggtggtgatgatggaacgcgagctg
gcggaacggagcgggcgcgagatcctggcggtattccgcggttatgccgccgctggcgta
gaacccggtttgatggggctggggccgatccccgcgacggccaaactgctcaaacaggcc
gggctgaacgtcggcgatatcgacctgtgggaattgaacgaggcgtttgccgcccagtcg
ctggcctgtatccgtgaaatcggcatggatccggatcgggtcaacccgaatgggggcgcc
atcgccatgggacacccgctggcgggaaccggcgccattctggccaccaagaccgtctat
gacatgcgccgacgtaacctgcataacgccgtgatcacattctgcgtcggcggcgggcag
ggcgtggccgtactgctgacgagggaataa

DBGET integrated database retrieval system