KEGG   Dickeya paradisiaca: Dd703_1375Help
Entry
Dd703_1375        CDS       T00927                                 

Definition
(GenBank) 3-oxoacid CoA-transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
dda  Dickeya paradisiaca
Pathway
dda00072  Synthesis and degradation of ketone bodies
dda00280  Valine, leucine and isoleucine degradation
dda00650  Butanoate metabolism
dda01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dda00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Dd703_1375
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Dd703_1375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dd703_1375
Enzymes [BR:dda01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Dd703_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ACS85177
UniProt: C6CDR0
Position
1575879..1576523
Genome map
AA seq 214 aa AA seqDB search
MNPRNRIARRAAEYFSAGDVVNLGIGIPSLCSDYAEPGVMFHTENGLVGMGPLASGIQAV
EGFSNATAMRFVPVPGASAFDSAESFALVRSGKLAASVLGGLQVSATGDLANWAQPGRVF
GMGGAMDLVNGARKVIITMELCTRDGQPKIVNTCSYPLTGQRCVDHIVTEQCVIDVTRDG
LMLVELLEGLTPDDIQRQVEPRLLISSRLKTLQP
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgaacccacgtaaccgtattgcccgccgcgcggcggaatacttctcggcgggggatgtc
gtcaatctgggcatcggcatccccagcctgtgcagcgactatgccgaacccggcgtgatg
ttccataccgaaaacggattggtcggcatggggccgctggcgtccggcatacaggcggtg
gaagggttttccaacgcgacggccatgcgctttgtgccggtgccgggggccagcgcgttc
gacagcgccgaatccttcgcgctggtgcgttccggcaagctggcggcgtcggtgctgggc
gggttgcaggtatcggcaaccggcgatctggccaactgggcgcagcccggccgggtgttc
ggcatgggcggcgcgatggatctggttaacggcgcgcgcaaggtcatcatcaccatggaa
ctctgtacccgcgacggccagccgaaaatcgtcaatacctgcagctatccgttgaccggg
cagcgttgtgtcgaccacatcgtgacggaacagtgcgtcatcgatgtcacgcgcgacggc
ctgatgttggtggaactgctggaggggctgacgcctgacgacattcagcgccaggtggag
ccgcgtttgctgatttccagccggttgaaaaccctacaaccctga

DBGET integrated database retrieval system