KEGG   Dickeya paradisiaca: Dd703_1565
Entry
Dd703_1565        CDS       T00927                                 

Definition
(GenBank) protein of unknown function DUF1047
  KO
K09911  uncharacterized protein
Organism
dda  Dickeya paradisiaca
Brite
KEGG Orthology (KO) [BR:dda00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Dd703_1565
SSDB
Motif
Pfam: MatP MatP_C RHH_4 CENP-B_N
Other DBs
NCBI-ProteinID: ACS85364
UniProt: C6C3L9
Position
1850096..1850557
AA seq 153 aa
MKYQQLENLECGWKWKYLVKKHREGEPITRLIEQSAAGAAIDELLKMESQPVKVLEWIAN
YMSPALENRMKQTIRARRKRHFNAEHQHTRKKSIDLEYIVWQRLAALAHRRGLTLSETVV
QLIEDAESKEKYASQMSVLKQDLQAILGNNGKK
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaaatatcagcaattagagaatcttgagtgcgggtggaagtggaaatacctggtgaag
aaacaccgcgagggtgagccgatcacgcgcctgattgaacagagtgccgcaggcgcggcg
attgatgaattgttgaaaatggagagccagccggtcaaggttctggaatggatcgccaac
tatatgagtccggcgctggaaaatcggatgaagcagacgattagggctcgccgcaaacgc
catttcaacgctgagcaccagcacactcgcaaaaagtcgatcgatcttgaatatatcgtc
tggcagcggctagctgctctggcgcataggcgcgggctgacattgtctgaaaccgttgtg
caattaatagaagatgcggaatcaaaagaaaaatatgccagccagatgtcggtgctgaag
caggatttgcaggctattttgggcaacaacggcaaaaagtga

DBGET integrated database retrieval system