KEGG   Dickeya paradisiaca: Dd703_1936Help
Entry
Dd703_1936        CDS       T00927                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dda  Dickeya paradisiaca
Pathway
dda00260  Glycine, serine and threonine metabolism
dda00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01130  Biosynthesis of antibiotics
dda01230  Biosynthesis of amino acids
Module
dda_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dd703_1936
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dd703_1936
Enzymes [BR:dda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dd703_1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACS85726
UniProt: C6C5T5
Position
2303744..2304934
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALRQLEEAFVSARRDPAFQQEFNDLLKNYAGRPTALTL
CKNLTAGTRTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVATAL
ACALMGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGSY
EQAHYLLGTAAGPHPFPTIVREFQRMIGEETKAQVREKEGRLPDAVLACVGGGSNAIGMF
ADFIDEPSVRLIGVEPAGLGIETGQHGAPLKHGRVGIYFGMKSPMMQTEDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALSAFRELSRHEGIIPALESSHALAHALKM
IKAEPEKEQILVVNLSGRGDKDIFTVHDILKSRGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacattacttaatccttattttggcgagtttggtggtcagtacgtaccacaaatcctg
atgcccgccctgcgtcagttggaagaagcctttgtcagcgcccgtcgcgacccggcattc
cagcaagaatttaatgacttattgaaaaattatgcgggccgccccaccgcgctcacgctc
tgtaagaacctgaccgccggcacccgcacccggctctacctgaaacgagaagatttgctg
cacggcggcgcgcataaaaccaaccaggtactcggtcaggcgttgctggcgaaacgcatg
ggcaaaaccgaaatcatcgcggaaaccggcgcaggtcagcatggggttgcaacagcactg
gcctgtgcgctgatgggcctgaaatgtcggatttacatgggcgccaaagacgtggagcgg
caatcgccgaacgtgtttcgcatgcggctgatgggggccgaagtcataccggtgcatagc
ggttcttccacattgaaagatgcctgcaacgaagcgttacgcgactggtccggcagctat
gaacaggctcattatctgctgggtactgcggccggcccgcatccctttccaactattgtg
cgtgaattccaacgcatgattggcgaagagaccaaagcgcaagtgcgtgaaaaagaaggc
cggttgccggatgccgtgctggcctgtgtaggcggcggctccaatgccatcggtatgttc
gccgactttatcgatgaaccctccgtgcgtttaataggtgtggaacctgccgggctgggc
attgaaaccggtcaacatggcgcccctttgaagcatggccgggtcggcatctactttggt
atgaagtcgcccatgatgcagacggaagacggccagatcgaagagtcctactccatctcc
gccgggctggatttcccctccgtagggccgcaacacgcttatctgaacagcattggccgg
gcggattatgtatctattaccgacgatgaagcgttgagcgcttttcgcgaactctcccgc
catgaagggatcatccctgcgctggaatcatcgcacgcgctggctcacgcactgaaaatg
attaaggctgaaccggagaaagaacaaattctggtggttaacctgtctggccgcggtgat
aaagacatttttacggttcacgatattctgaaatcccggggagaaatctaa

DBGET integrated database retrieval system