KEGG   Dickeya paradisiaca: Dd703_2597Help
Entry
Dd703_2597        CDS       T00927                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
dda  Dickeya paradisiaca
Pathway
dda00071  Fatty acid degradation
dda00280  Valine, leucine and isoleucine degradation
dda00281  Geraniol degradation
dda00310  Lysine degradation
dda00362  Benzoate degradation
dda00380  Tryptophan metabolism
dda00410  beta-Alanine metabolism
dda00640  Propanoate metabolism
dda00650  Butanoate metabolism
dda00903  Limonene and pinene degradation
dda00930  Caprolactam degradation
dda01040  Biosynthesis of unsaturated fatty acids
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
dda01130  Biosynthesis of antibiotics
dda01200  Carbon metabolism
dda01212  Fatty acid metabolism
Module
dda_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dd703_2597
   00650 Butanoate metabolism
    Dd703_2597
  Lipid metabolism
   00071 Fatty acid degradation
    Dd703_2597
   01040 Biosynthesis of unsaturated fatty acids
    Dd703_2597
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dd703_2597
   00310 Lysine degradation
    Dd703_2597
   00380 Tryptophan metabolism
    Dd703_2597
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dd703_2597
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dd703_2597
   00281 Geraniol degradation
    Dd703_2597
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dd703_2597
   00930 Caprolactam degradation
    Dd703_2597
Enzymes [BR:dda01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dd703_2597
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dd703_2597
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Dd703_2597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF362
Motif
Other DBs
NCBI-ProteinID: ACS86374
UniProt: C6C9V2
Position
complement(3043625..3045769)
Genome map
AA seq 714 aa AA seqDB search
MSEEQRAADSKPMTTAFTLSWLPDDIAVVHIDVIGERVNTLKSAFAEHVETILAQAAAKG
MPRGMIIISGKPDSFIAGADIGMLDACPDASAAQALSRQGQDTFSRLSRLSFPVVAAIHG
ACLGGGLELALACDYRICTPDDATVLGLPEVQLGLLPGAGGTQRLPRLIGADRALDLMLT
GRRLRAAQAKKWGLVDDVVPRTILIEAAIAQIRLGKRKARGCGQKGRQRFLSLPLVRRVL
FDRIRKLTRAKTQGHYPAAEQVIDVVICGLTQGETAGYAAEARAFGQLVMSPVSKALRRL
FFASSALKSAPEGGNVGPLRRVGIVGGGLMGGGIAGITVLQGHLPVRLKDIDHQGVIHAL
RHSWRQLDELAARRRITPAGQRQRMSLISGGIDYQGFEQADVVVEAVFEDLALKRRIVAD
IEAITPEHTIFATNTSSLPIHQIADGARRAERIVGLHYFSPVEKMPLVEVIPHAGTHPDV
VATVVELAKRQGKTAIVVADGAGFYVNRILTPYLNEAARCLLEGEPVDSIDRALVKFGFP
VGPFALLDEVGLDVAMKIAPVLYQALGERFGVSPVLEAMLRDNRRGRKNHRGFYRYAQRG
IGWRRAEKEVDDHVYTLLGVTPKPHLAPELIAQRCVMMMLNEAAYCLAESIIRSERDGDI
GAVFGIGFPPFLGGPFHYMRQLGMDTVAASLRILREQYGERFRPCEALLQENGE
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagagcaaagagcggcggatagtaagccaatgaccactgcattcaccctgagc
tggctaccggatgatatcgctgtggtgcatatcgatgtcattggcgaaagggttaacacc
ctgaaatcggcgtttgccgaacacgtcgagacgattctggcgcaggcggcggcaaaaggc
atgccacgcgggatgatcatcatttctggaaaacccgacagttttatcgccggtgcggat
atcggcatgctggatgcctgcccggatgccagtgcagcgcaggcattgtcccgacaaggg
caggacacgttttcccgtctgagccgcttatcgtttccggtggtggcggctatccatggc
gcttgtctgggcggtgggttggagttggcgctggcgtgtgattatcgaatctgtacgcct
gacgatgcgactgtgctggggttgcctgaagtacagttggggctgttgccgggcgccggc
ggaacgcaacggcttccacgcctgattggtgcggatcgggcgctggatctgatgttgacc
gggcgtcggctgcgcgccgcacaggcaaaaaagtgggggctggtggacgacgttgtgccg
cgaacgatcctcattgaggccgccatcgcacaaattcgcttaggtaaacgcaaagcgcgt
ggttgcgggcaaaaggggcgacagcgttttttgtcgctaccgcttgtgcgtcgcgtgttg
ttcgatcgaatacggaaactgacccgggcgaaaacccaggggcactatcctgcggcggag
caggtgattgatgtggtgatctgcgggttaacacagggggaaacggctggctacgccgcg
gaagcgcgggcgtttggtcagttggtgatgtcgccggtttcgaaagcgttgcggcggttg
ttttttgcatcgtcggcgctgaagagcgcgccggagggcggtaacgtcggcccattgcgc
cgggtgggcattgtgggtggcggcctgatggggggcgggattgccggtatcactgtgctg
caagggcatttaccggtacgtctcaaggatattgatcatcaaggcgttatccatgctttg
cgccatagctggcggcagcttgacgagctggcggcacgtcggcgcatcactcccgccggg
caacgtcagcgtatgagcctgatatccgggggtatcgattatcaggggttcgaacaggca
gatgtcgtggttgaagcggttttcgaagatctggcgctgaaacggcgaattgtggccgat
atcgaggcgataacaccggaacatactatctttgccaccaacacgtcgtcgctgcctatc
catcagatcgccgacggggcacgtcgagctgagcggatcgtcgggctgcactatttcagt
ccggtagagaaaatgccgctggtcgaggtgatccctcatgcggggactcatcccgacgta
gtggcaacggtggtggaactggcgaaacgtcaagggaaaaccgcgatagtggttgccgat
ggcgccggtttttatgtgaaccgtattctgacgccgtacctgaatgaagcggctcgctgc
ctgctggaaggcgagccggtggatagcatcgatcgggcattggtgaagtttggttttccc
gtcggcccattcgcgctgttggatgaagtcgggctcgatgtggcgatgaagattgcaccg
gtgttgtatcaggcgttgggcgagcggtttggcgtatcgccggtgctggaggcgatgctg
cgggataaccggcgtggcaggaagaatcaccgtggcttttatcgttacgcgcagcgcggt
atcggttggcgtcgtgcggaaaaagaggtggatgatcacgtttatacgttattgggtgtg
acgcctaaaccgcatttggccccggagcttatcgctcagcgatgcgtgatgatgatgttg
aatgaagccgcgtattgcctggcggagtccataatccgcagtgagcgggatggagatatc
ggcgccgtgtttggtatcggttttccaccgttcctcggggggcctttccactatatgcgg
caattgggtatggatactgtcgccgcgtctttgcgtattctgcgtgagcagtacggtgag
cgtttccgcccttgtgaggcgctgttgcaagaaaatggcgaatag

DBGET integrated database retrieval system