KEGG   Dickeya paradisiaca: Dd703_3006Help
Entry
Dd703_3006        CDS       T00927                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dda  Dickeya paradisiaca
Pathway
dda03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dda00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dd703_3006
Enzymes [BR:dda01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Dd703_3006
DNA repair and recombination proteins [BR:dda03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Dd703_3006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 UvrD-helicase AAA_16 AAA_22 DUF2075 UvrD_C AAA_28 PhoH CbiA T2SSE Bcl-2 AAA_29 TrwB_AAD_bind MukB SRP54 AAA AAA_24 NTPase_1
Motif
Other DBs
NCBI-ProteinID: ACS86781
UniProt: C6CC21
Position
complement(3496810..3498660)
Genome map
AA seq 616 aa AA seqDB search
MLELLLEAQRRHLLRPLDVQFAHMLAGDEPYLLLAAACLSNHAGAGHVCLPLEQLQGDRL
FDGRDPVLARQIMQLLGSPNVERWRSELQRCEPVDDGHRPTPLVLERDMLYLQRSWRNEC
QVAHFIANGQLTTDMDERHIRQVLDTLFPTVEKEVDWQKIAAAVALTSRMAVISGGPGTG
KTTTVAKLLAALIALRGDAQPLRIQLAAPTGKAAARLTESLGVALRQLTLSEAQLRSFPQ
AACTLHRLLGAMPDSQQLRHHRDNPLHLDLLVVDEASMVDLPMMAHVMAALPAHARVIFL
GDRDQLASVEAGAVLGDICHFTGQGYSPARTEQLQRLTGCALPPPSPKASSVADSICLLR
KSYRFAASSGIGLLAQAVNQGDERRVKDVWHGGYSDVGCHPLREASDYQQLLTLAVTEYR
RYLQAIDDGAEPAVVLRAFQQFRLLCALREGPFGVEGLNQGIEQALRSARLIPALPANGS
RWYVGRPVMIARNDTILGLFNGDIGIALLNAQGELRVCFPLPDGSVKPVPPSRLPPHETA
FVMTVHKSQGSEFEHTALVLPNMMLPLLTRELIYTAITRARQQLSIFADEDILCQSVCAA
TRRYSGLAQRILMLAQ
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagttactgcttgaggctcagcgcaggcatctgttgcgcccgctggatgtgcag
tttgcccacatgctggcaggggatgaaccctacctgctgctggcggcggcatgtctgagc
aatcatgccggggcggggcatgtctgcctgcctttggagcagttacagggtgatcgtttg
tttgacggacgtgaccctgtgttggctcgccagataatgcagttgctcggctctccaaat
gtggagcgctggcgtagcgagttgcagcggtgtgagccggtcgacgatggtcatcggcca
acgccgttggtgctggagagggatatgctctatctacagcgcagttggcggaacgaatgt
caggtagcgcattttatcgccaacgggcaactgacgacggatatggatgagcgccatatc
cgtcaggtactagacactctgttcccgacggtggaaaaagaggtcgactggcagaagatt
gcggctgccgtggcgttgaccagccgcatggcggtgatttccggcggtcccggtacaggg
aaaaccactacggtcgccaaactgctggcggcgctgattgcgttgcgtggcgacgcccag
ccgttgcgtatccaactggctgcgccgaccggcaaggccgccgcccgtctgacggaatct
ctgggcgttgcgcttcgccaattgacgctgagcgaggcgcagttgcgcagttttccgcaa
gccgcatgcacattgcatcgtttgctgggtgcgatgccggatagccagcagttgcgtcat
catcgtgataatcccttgcatcttgatctgttggtggtggatgaagcctcaatggtggat
ttaccgatgatggcgcatgtgatggcggctctgcctgcgcatgcccgcgttatctttctg
ggggatcgcgatcagttggcgtccgtggaggcgggtgcggtgctgggcgatatctgtcat
ttcaccgggcaggggtatagcccggctcgtaccgaacagctacaacgtttgaccgggtgt
gcgttgccgccgccatcgccaaaggcatccagcgtggcggatagcatctgcctgttgcgc
aaaagctaccgttttgccgcatcgtcaggcatcgggttgctggcgcaggcggtgaatcag
ggagatgaacggcgggtgaaagacgtttggcacggcggctatagcgacgtcggatgtcat
ccgttgcgggaagcgtcggattaccaacagttgctgacgctggcggtgacggagtatcga
cgttatctacaggcgatcgacgacggcgccgaaccggcggtggtgctgcgcgcgttccag
caatttcgcctgctttgcgctctgcgggaagggccgttcggcgtagaggggttgaatcag
ggtatcgagcaggcattgcgcagcgccaggttgatccccgcgttacccgccaatggctct
cgttggtacgtcggaaggccggtgatgatcgcgcgtaatgacactattctggggctgttt
aacggtgatatcggtatcgcattgctgaatgcgcagggtgaactgcgggtctgcttccca
ttgccggatggcagcgtcaaaccggtgccgcccagccgtctgccaccgcatgaaactgcg
tttgtcatgacggtgcataaatctcaagggtctgagtttgaacatacggcattggtgttg
cccaacatgatgctgcctctgctgacccgagaattgatttacaccgcaataactcgcgca
cgccagcagttgtcgatatttgccgacgaagacattctgtgtcagtccgtgtgcgccgct
acccggcgttatagcggcctggcgcagcgtattctgatgctggcgcagtag

DBGET integrated database retrieval system