KEGG   Dickeya paradisiaca: Dd703_3299Help
Entry
Dd703_3299        CDS       T00927                                 

Definition
(GenBank) thiol:disulfide interchange protein DsbC
  KO
K03981  thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dda  Dickeya paradisiaca
Brite
Enzymes [BR:dda01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dd703_3299
Chaperones and folding catalysts [BR:dda03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Dd703_3299
Secretion system [BR:dda02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Dd703_3299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 DsbC_N DSBA Thioredoxin_4 Thioredoxin_3 DUF1525 Redoxin TraF
Motif
Other DBs
NCBI-ProteinID: ACS87061
UniProt: C6CDW7
Position
complement(3865547..3866266)
Genome map
AA seq 239 aa AA seqDB search
MKKQVLLLAVLTAMMSGGVAQADDAAIKQTLSRLGLQNAEIQPAPVAGMKTLLTESGVLY
ITEDGKHLLQGPLYDVGGKTPVNVTNGILMNKMEALKDQMIVYKAAKEKHVITVFTDIIC
GYCHKLHEQMKDYNALGITVRYLAFPRQGLNSQAEKDMQSIWCVADRNKAFDAAMKGDEI
SPATCKTAIAPHYQLGILFGVQGTPAIVLDDGTVVPGYQDPKEMMAMLEAHRASQKSGG
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacaggtattactgctggcggtactgacggcgatgatgagcggcggcgttgct
caggcggatgacgcagccatcaaacaaacgctgagccgtctcggcttgcaaaacgccgag
atccagccggcgccggtcgcggggatgaaaacgctgttgacggaaagcggcgtgctgtac
atcaccgaggacggcaagcatctgttgcaggggccgttgtacgatgtcggcggtaaaaca
ccggttaacgtcaccaacggtatcctgatgaacaagatggaagcactcaaagatcagatg
atcgtgtacaaagccgcgaaggagaaacatgtgatcacggtatttaccgatatcatctgc
ggctactgtcacaagctgcatgagcagatgaaagactataacgcgctgggcattaccgtg
cgttatctggcgtttccgcgtcaggggctgaactcgcaggcggagaaagacatgcagtcc
atctggtgcgtggcggatcgcaacaaggcgttcgacgcggcgatgaaaggcgatgagatt
tcgccggccacctgtaaaactgccatcgcgccccattatcagttgggtattctgttcggc
gtccagggcacgccggcgatcgtgctggatgacggtacggtggtgccggggtatcaggat
ccgaaagagatgatggctatgctggaggcgcatcgggcgtcgcagaaatcgggtggttaa

DBGET integrated database retrieval system