KEGG   Dickeya paradisiaca: Dd703_3351Help
Entry
Dd703_3351        CDS       T00927                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
dda  Dickeya paradisiaca
Pathway
dda00790  Folate biosynthesis
dda01100  Metabolic pathways
Module
dda_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dd703_3351
Enzymes [BR:dda01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Dd703_3351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ACS87113
UniProt: C6CE19
Position
complement(3924660..3925493)
Genome map
AA seq 277 aa AA seqDB search
MQLKARGAVLDLSRPQVMGILNVTPDSFSDGGKHNTLDAAIRHANDMITAGAAIIDIGGE
STRPGAGEVSVDDELERVIPVVDALSRRFDVWISVDTSKPEIITAAADVGAHLINDIRSL
QLPGAISAAAATGLPICLMHMQGLPQTMQHSPQYDDVLSDVEVFFEHHIAQCVDAGIKRE
RLLLDPGFGFGKDLQHNYRLLACLEQLHHFGLPLLVGMSRKSMIGQVLNVPPGERVYGSI
ACAVIAAMKGAQIIRVHDVKATVDALRIVEATLSAKE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcaactaaaagctcgtggtgccgtgctggatttatctcgtccccaggtcatggggata
ttgaatgttacgccggattctttttccgatggcggtaagcacaatacattggatgcagcc
attcggcatgcgaacgacatgattacggccggtgcagcaatcattgatattggcggtgaa
tctactcgccctggggcaggcgaagtcagcgttgacgatgaactggaacgggtgatcccg
gtagttgatgccttgtctcgtcgttttgatgtgtggatttcggttgatacatcgaagccc
gaaattattactgccgctgccgacgtgggggctcatttgatcaacgatatccggtcactt
caacttcccggtgcgataagtgcagcggctgcgacagggcttccgatctgtctgatgcat
atgcaaggtttgccgcaaaccatgcagcattccccccaatatgatgatgtgcttagcgac
gtagaggtatttttcgagcatcatatcgcccaatgcgtagatgcaggcatcaaacgggaa
cgattgctgctggatcctggattcggctttggtaaagatttgcagcataattatcggttg
ctggcatgcctggaacagttacatcattttgggttgcctttactggttggtatgtcccgc
aaatccatgattggacaagtattgaatgttcctccaggggagcgggtttatggaagtatt
gcgtgtgcagtgattgccgcgatgaaaggtgctcagattattcgcgtccatgatgtcaaa
gcgaccgtagatgcattacgtattgttgaagcaacactatcagcgaaggaatag

DBGET integrated database retrieval system