KEGG   Dickeya paradisiaca: Dd703_3756Help
Entry
Dd703_3756        CDS       T00927                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
dda  Dickeya paradisiaca
Pathway
dda00860  Porphyrin and chlorophyll metabolism
dda01100  Metabolic pathways
dda01110  Biosynthesis of secondary metabolites
dda01120  Microbial metabolism in diverse environments
Module
dda_M00121  Heme biosynthesis, glutamate => heme
dda_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dda00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dd703_3756
Enzymes [BR:dda01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Dd703_3756
Exosome [BR:dda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dd703_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD TP_methylase
Motif
Other DBs
NCBI-ProteinID: ACS87510
UniProt: C6C4V3
Position
complement(4357147..4358169)
Genome map
AA seq 340 aa AA seqDB search
MSNAFPGTFPGRRMRRLRRHDFSRRLVAEHQVTVNDLIYPVFVMEGTGTRQEVPSMPGVY
RLTIDELLSEAEAVAKLGIPVLSLFPVIEADKKSLHAEESYNPDGLVQRAVRALKDAVPE
LGLLTDVALDPYTTHGQDGVIDDEGYVINDITREILVRQALSHAQAGAEIVAPSDMMDGR
IGAIRDRLENQGLVNTQIMAYSAKYASCYYGPFRDALGSAGNLKGGNKKTYQMDPANGDE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMQMAAIQNGWL
QEQPLVMESLLCFKRAGADGVLTYFAKRVAQWLHEEAQRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcttttcccggtacatttcccggtagacgcatgcgtcgcttgcgtcgtcat
gatttcagccgtcgtctggtcgcggaacatcaggtaacggttaacgatctgatctatccc
gtgtttgtcatggaaggaaccggaacccggcaggaagttccctctatgccgggcgtgtat
cgcctgaccatcgacgaattgctcagcgaggcggaagcggtggcgaagctggggattccg
gtgctgtcgctgttcccggttattgaggcggataaaaaatcgctgcatgcggaagagtca
tataacccggatgggttggtgcaacgcgcggtgcgggcattgaaagatgcggtgccggag
ctgggcctgttgaccgatgtagcgttggatccttacaccacgcatggtcaggatggcgtg
attgatgacgagggctatgtcatcaatgatattactagagaaattctggtgcgtcaggcg
ctgtcccatgcccaggccggtgctgagatcgtagcacccagcgatatgatggacgggcgt
atcggcgccattcgcgatcgactggaaaatcagggactggttaatacgcagatcatggcc
tattccgctaagtacgcctcctgttattacggcccattccgtgacgcgctaggctctgcg
ggcaatttgaaaggcggcaacaagaaaacctatcagatggatccagccaatggcgatgaa
gcgctgcaagagattgcgcaggatctgcaggagggcgcggacatggtgatggttaagccc
ggcatgccgtacctggatgtggtgcgccgcgtgaaggataccttcggtgtgccgaccttt
gcctaccaggtgtccggtgagtacgcgatgcagatggcggccattcagaatggctggcta
caggagcagccgctggtgatggagtcgttgctgtgctttaaacgcgccggcgccgacggc
gtgctgacctactttgccaaacgtgtagcgcagtggctgcacgaagaagcccagcggcgc
tga

DBGET integrated database retrieval system