KEGG   Dickeya paradisiaca: Dd703_3891Help
Entry
Dd703_3891        CDS       T00927                                 

Definition
(GenBank) Cellulase
  KO
K20542  endoglucanase [EC:3.2.1.4]
Organism
dda  Dickeya paradisiaca
Brite
Enzymes [BR:dda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Dd703_3891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_8 Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: ACS87644
UniProt: C6C635
Position
complement(4506484..4507482)
Genome map
AA seq 332 aa AA seqDB search
MIKPVWRVGMVLLMMWFSMAASAASGWDSYKSRFMTQDGRILDTGNKNISHTEGQGFAML
MAVYFNDRSAFDGLWTWTQTHLQDNKSGLFYWRYNPMDSNPVVDRNNAADGDVLIAWALL
KAGEKWQENRYLLASDVIQKAILARNVVQFAGRTVMLPGANGFNKNSYVILNPSYFLFPA
WQDFARHSHLQAWRQLIDDGLALLGEMRFGKVELPVDWVALNADGTMAPATNWPPRFSYD
AIRIPLYLYWYDAKTLALVPFQLYWRNYSRLNTPAWIDVLNNNTAPYSMRDGLLAIRDLT
MGSPGDIPASLNASEDYYSSSLHLLAYIASGR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagccggtatggcgtgttggcatggtgttactgatgatgtggttcagtatggcg
gcgtcggcggcaagcgggtgggacagctacaaaagtcgttttatgactcaggacggccgg
attttggataccggcaacaagaatatcagtcacacggaagggcaagggttcgccatgctc
atggcggtgtattttaatgatcggagtgcgtttgacggcctgtggacttggacgcaaaca
catttgcaggataacaagagcggtctgttttactggcgttacaatccgatggacagtaat
ccggtggtggatcgcaacaatgctgcggatggtgacgtattgattgcctgggctttactg
aaagccggggagaaatggcaggagaaccgttatctgctggcctcggatgtcattcaaaaa
gcgatcctggcccgtaacgtggtgcaatttgccgggcgtaccgtgatgttgccgggggcc
aacggttttaacaagaacagctatgtcattctcaatccatcctattttttgttcccggcc
tggcaggatttcgcgcgccacagccatcttcaggcctggcgtcagctgattgacgatggg
ctggcgttgttgggcgaaatgcgtttcggcaaggtggaactgccggtggactgggtagcg
ctgaatgcggatggcaccatggcgcccgcaaccaactggccgccccgtttcagctacgat
gccattcgcatccccctctatctgtattggtatgacgccaaaacgttggcgttggtgccg
tttcagctttactggcgtaattactcccggctgaatacgccggcatggattgatgtactc
aataacaataccgcgccttacagcatgcgggatgggttgctggcgatccgcgatctgacc
atgggcagccccggcgatattccggccagcctgaatgcgtcggaggattattactcatcc
agtctgcacctgttggcctatatcgccagcggccgataa

DBGET integrated database retrieval system