KEGG   Dickeya zeae Ech586: Dd586_0049Help
Entry
Dd586_0049        CDS       T01138                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00010  Glycolysis / Gluconeogenesis
ddc00052  Galactose metabolism
ddc00500  Starch and sucrose metabolism
ddc00520  Amino sugar and nucleotide sugar metabolism
ddc00521  Streptomycin biosynthesis
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
ddc01130  Biosynthesis of antibiotics
ddc01200  Carbon metabolism
Module
ddc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ddc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd586_0049
   00052 Galactose metabolism
    Dd586_0049
   00500 Starch and sucrose metabolism
    Dd586_0049
   00520 Amino sugar and nucleotide sugar metabolism
    Dd586_0049
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dd586_0049
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dd586_0049
Enzymes [BR:ddc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dd586_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACZ74947
UniProt: D2C0K4
Position
57585..58706
Genome map
AA seq 373 aa AA seqDB search
MANSQPLGKTLANALSQLERLSLETTSGWAAALDIAPGSVQNLMNFLEKQHIIQQKSPGV
ELHPQSPVVIGFDLGGTKVNGRLTTLSGEVLAHTSQPTAKGDEQAALQHMSSLAQALLQQ
AHIAPNRLKQVAIGIPGSIDKQRNVQLSPNLRLPARLPNLFSLPDGQSCPVVFENDVNLA
ALGEYHYGHGKGSDSLVFIAFGTGVGMGIITQGSIISGHNGMAGEIALLPLSATPYDDAK
ISVGGVFEDRVSSSAIRQRYQGGETEVIDIFRRAEQGDEQARTVLENTAQIAALGVASAV
SLLNPEWLVLGGGIGARPAFHERVRQHVQTLLPVPVQLVGSALLDEAGVVGAVHLAREHC
LAALAWHDVREAV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactcgcagccacttggtaaaactcttgcaaacgcgctttctcagttggagcgt
ctgtcgctggaaacgacttccggctgggctgccgccctcgatattgcgccggggagtgtg
cagaatttaatgaattttctggaaaaacagcacattatccagcagaaatcaccgggtgtt
gaattgcacccgcagtcgcctgtggtgattggttttgatctgggcggcactaaagtcaat
gggcggctgacaacgttgagcggcgaggtattggcgcacacgtcacagcctaccgctaaa
ggtgatgaacaggcggcgctgcaacacatgtcatcgctggcgcaggcactactgcaacag
gcacatatcgcaccgaaccgcttgaaacaagtcgctatcggtattcccggttcaatcgat
aagcaacgcaatgtacagctttcccctaacctgcgtcttcctgcccgcttacccaacctg
ttttctctgcctgatgggcagtcgtgcccggtggtattcgaaaatgacgttaacctggcg
gcattgggggaataccactatgggcatggcaaaggcagcgactcgctggtgtttatcgcc
ttcggtaccggtgtcggcatggggattatcacacaaggcagcatcatcagtgggcacaac
ggtatggcgggggaaatcgccctattaccgttgagcgcaacaccttacgacgacgccaaa
atttccgtcggcggggtgtttgaagatcgagtcagcagcagcgcgattcgccagcgctat
cagggtggcgagactgaggttatcgatattttccgccgtgcagaacaaggggatgagcag
gcgcgtaccgtgctggaaaacaccgcacagattgccgcgttgggcgtggcttcagccgtg
agtttgctgaatcctgaatggctggtgctgggcggcggaattggtgcgagacccgcgttt
catgagcgtgtccgtcagcatgtacaaacattgctgccggtgccggttcagttggtcggc
agcgccttgctggatgaggcgggtgtggtcggtgccgtgcatctggccagagaacactgc
ctggccgcattagcctggcatgatgtgagggaagcggtatga

DBGET integrated database retrieval system