KEGG   Dickeya zeae Ech586: Dd586_1213Help
Entry
Dd586_1213        CDS       T01138                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00010  Glycolysis / Gluconeogenesis
ddc00052  Galactose metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
ddc01130  Biosynthesis of antibiotics
Module
ddc_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dd586_1213
   00052 Galactose metabolism
    Dd586_1213
Enzymes [BR:ddc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dd586_1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACZ76097
UniProt: D2BVE3
Position
complement(1351574..1352644)
Genome map
AA seq 356 aa AA seqDB search
MSNDPVEPRAPHTALAPDGQPFQLTLLQNRHGTRVTLMDWGATWLSCQLPLPDGTMREVL
LGCAPDQYPHQSAYLGASVGRYANRIANATVHQGDTPIHLLANQGDHQLHGGPDGFHARR
WQVVEQRDDQVTYQLFSPDGDQGFPGALTARVSYQLTDQNALDIEYQAEVDQPCPVCLTN
HAYFNLDGELTDVRHHQLQLMADYYLPVNQDGIPGDGLREVAHSSFDFRQRKTLIQDFLA
DADQQAVQGYDHAFLLHRTGGSSESPAASLWSADGKVQMLVYTSAPALQLYSGNFLAGTP
SRDGPLYANYAGLALESEFLPDSPNHPNWPQPDCWLKPGKRYRSLTRYAFIVTPAD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgaccctgttgaaccacgagcgccacacacggcgctcgccccagatggtcag
ccatttcagctgaccctactgcaaaatcgccacggtacgcgggtaacgctgatggactgg
ggagccacctggctctcttgtcagttaccgttgcccgacggaacgatgcgagaagtgcta
ttgggctgtgcgcctgatcagtacccgcatcagtctgcctatctgggcgcatcggtgggg
cgttacgccaaccgcatcgccaacgccaccgtacatcagggtgacacccccattcacttg
ctggctaatcagggcgatcaccagttgcatggcgggccggacggttttcatgcccgccgc
tggcaggtcgtggaacaacgtgacgatcaggttacttaccagctattttcgccggatggt
gatcagggcttccccggtgcgctgaccgcacgagtcagttatcaactcaccgatcagaat
gcgctggatattgagtatcaggccgaggtcgatcaaccctgcccggtatgcctgactaat
catgcctatttcaacctcgacggcgaactaaccgatgtgcgtcaccatcaactgcaactg
atggcggattactatctgccggtcaatcaggatggtatccccggtgatggattacgggaa
gtggcacacagcagtttcgattttcgccagcgcaaaaccttgatacaggactttctggcc
gatgccgaccagcaggcggttcaaggttatgaccacgcctttttgctgcaccgtaccggc
ggttccagcgaaagcccggcggccagcctgtggtcagcggacggcaaagtgcagatgctg
gtgtacaccagcgcgccggcgctacagctctacagcggtaactttctggcgggcacgccg
tcacgcgatgggccgctttatgccaactacgccgggctggcgctggaaagcgaatttctg
ccagatagccccaaccacccgaactggccgcagcctgactgctggctaaaaccgggcaag
cgctaccgctcactgacccgctacgcatttatcgtcactccggctgactga

DBGET integrated database retrieval system