KEGG   Dickeya zeae Ech586: Dd586_1254Help
Entry
Dd586_1254        CDS       T01138                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00040  Pentose and glucuronate interconversions
ddc00052  Galactose metabolism
ddc00500  Starch and sucrose metabolism
ddc00520  Amino sugar and nucleotide sugar metabolism
ddc01100  Metabolic pathways
ddc01130  Biosynthesis of antibiotics
Module
ddc_M00362  Nucleotide sugar biosynthesis, prokaryotes
ddc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dd586_1254
   00052 Galactose metabolism
    Dd586_1254
   00500 Starch and sucrose metabolism
    Dd586_1254
   00520 Amino sugar and nucleotide sugar metabolism
    Dd586_1254
Enzymes [BR:ddc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dd586_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACZ76138
UniProt: D2BVI4
Position
1399538..1400437
Genome map
AA seq 299 aa AA seqDB search
MTALKAIIPVAGLGMNLLPVTKAIPKEMLPLVDRPVIEKIVNECVNAGIKEIVLVTHASK
NAIENHFDTSFELESMLEERAKRQLLAEVKSICPPGVTIMNVRQGQTLGLGHAVSCAHPI
VGNAPFVVVLPDVVMDDSSADQSKDNLALLISRFEETGHSQVLVKHRPYEVLPEYSIVEC
EKPLNQAGDASAITSMIEKPELAPVEGSDLSAVGRYVLTAEAWPILENIVAGAWGRIQLT
DAIAELIKTQQVDAVQMTGRSFNCGRKMGYVQAFVSYGLRNPELGDAFKTKIKALLEKY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattaaaagcgattatccctgttgccggcttagggatgaacttgttgccggtt
accaaagcgattccgaaagagatgcttccgctggttgacaggccggtaatcgaaaagatt
gtcaacgaatgcgttaatgcggggattaaagagattgtgctggtcacgcacgcctctaaa
aatgccattgaaaaccattttgatacctctttcgagctggagtcgatgctggaagagcgc
gccaaacgtcaattactggcggaagttaagtccatttgcccgccgggcgtgaccatcatg
aacgtgcgtcaggggcagacgctgggcctggggcacgcggtgtcctgcgctcacccgatt
gtcggcaatgcgccgtttgtcgtggtgctgccggatgtggtgatggacgacagttcagcg
gatcagtcaaaagacaatctggcgctgctgatttcccgttttgaagaaaccggccacagc
caggtgctggtcaaacaccgcccgtacgaagtgttgccagagtactccatcgtggaatgc
gagaagccgctgaatcaggcgggcgacgcgtcggcgatcacctccatgattgagaaaccg
gaactggcgccggtggaaggctcggacctgtccgcggttggccgttatgtgctgacggcc
gaagcctggccgattctggaaaacatcgtggcgggcgcgtggggtcgtatccaactgacc
gatgctatcgctgagcttatcaaaacccagcaggtggatgcggttcagatgacgggtcgt
agttttaactgcggacggaagatgggatacgtgcaagcgtttgtttcctacggcctgcgc
aacccagaactgggtgatgcctttaaaactaaaatcaaggcgttgctggagaaatattga

DBGET integrated database retrieval system