KEGG   Dickeya zeae Ech586: Dd586_1273
Entry
Dd586_1273        CDS       T01138                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dd586_1273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddc02044]
    Dd586_1273
Secretion system [BR:ddc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dd586_1273
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: ACZ76157
UniProt: D2BVK3
Position
1419461..1421497
AA seq 678 aa
MANSTGLQFTVKIGALADTTFAVVDFELSEALNQPFALSLSLASSQADIDFGAVLDQPCE
LLVWYEGELQRRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQTKKPDEI
ITELLQEAGISDFAFALRHEHAAREYCVQYRESDLAFINRLAAEEGMFYYHEFEAGKHRV
VFADDAGALTKGPELFFNLATQGLSEGAYVRRFRYAEAVSTAEVELKDYSFKTPAYGLSH
KKTSNELAHQRESYQHFDYPGRFKQDPSGKAFTGYRLDALRAGAMTGSGESNAAELRPGG
TFTLTEHPNPAFNLAWQVVAVTHSGQQPQALEEESGGEPTTISNSFEVVKATTTWRAAMP
YKPMVDGPQIAMVVGPAGEEIYCDKFGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPIITGRTFHATNPTPYVLPEHKTRTTLRTDTHKGSGF
NELRFEDEATREQIYLHAQKDMDAVINNIHRQSVGLDQHLSVANDQFQRVDRHSHRTIGQ
DDFEQIGQDHHQSIGRHFVQRITQSFKRFIGGGEITRIDGSRQTTLSGSEETLIGAHQRV
LVNTDSYLKAADIVLEAGQSLTIKAPGGFIKIDGAGVTISGTLVKINDGGSAGAGTAPVS
IEPESPTRPTLPDAPDRR
NT seq 2037 nt   +upstreamnt  +downstreamnt
gtggccaacagtacaggattgcagtttaccgtgaaaatcggcgcattggcggacacgacc
ttcgcggtggtggattttgaactcagtgaagcgctgaaccagccgtttgcgctgtcgctg
agccttgccagcagtcaggcggatattgacttcggcgcggtgctggaccagccatgcgag
ctgctggtgtggtacgaaggcgaactgcagcgccgggtcagcggtatcgtcagccgcttt
gcccagggcgacaccggttttcgccgcacccgctatcaggccgaggtgcgcccggcgctg
tggcggctcggtctgcgtaccaacgcccgcatcttccagaccaaaaaaccggatgagatc
atcaccgaactgttgcaggaagccggtatcagcgactttgcctttgccctgcgccacgag
catgcggcacgtgagtactgcgtgcagtaccgcgaaagcgacctggcgttcatcaaccgg
ctggcggcagaagaagggatgttctactaccacgagtttgaggccgggaaacaccgggtg
gtgtttgccgatgacgccggtgcgctgaccaaaggccccgagctgttcttcaatctcgcc
acgcaagggctgagcgaaggggcgtatgtgcgccgtttccgttatgccgaggcggtgagc
accgctgaggtggaactgaaggattacagcttcaaaaccccggcgtatggcctgtcgcac
aagaaaaccagcaacgaactggcgcaccagcgtgaatcctaccagcacttcgattatccc
ggccgcttcaagcaggacccgagcggcaaggcctttaccggctaccggctggacgcgctg
cgtgccggggcgatgaccggcagtggcgaatccaacgccgccgaactgaggccgggtggc
acctttaccctgaccgagcacccgaacccggcgtttaacctggcctggcaggtggtggcg
gtgacccacagcggccagcagccgcaggcgctggaagaggaaagcggtggcgagccgacc
accattagcaacagcttcgaagtggtgaaagccaccaccacctggcgggcggccatgccg
tacaagccgatggtggacggcccgcagattgccatggttgtcggcccggcgggggaagag
atttactgtgataaatttggccgggtgaagctgcagttcccgtgggaccgctacggtgcc
agcgacgaccagagctcctgctgggtacgcgtcagtcagggctgggccggtggccagtac
ggcttgatcgccattccgcgcatcggtcatgaagtggtggtgagctttctggaaggcgac
ccggaccagccgattatcaccggtcgcacctttcatgcgactaacccgacgccgtatgtc
ttaccggagcataaaacccgcaccaccttgcgtaccgatacgcacaaaggcagcggattc
aacgagctgcggtttgaagatgaagcgacccgggagcaaatctacctgcacgcgcaaaaa
gacatggatgcggtgattaacaacattcatcgccagagtgtcgggttggatcagcatctg
agcgtagcgaatgaccagttccagcgggtcgatcgtcatagccatcgcaccatcggacag
gatgactttgagcagattggtcaggatcatcaccagtcaatcgggcgtcatttcgtgcaa
cgcatcacccagtcgttcaagcgctttattggtggcggcgagattacccgtattgacggc
agccgccagaccacgttgtccggttcggaagagaccttaattggcgcacatcagcgtgtg
ctggtcaataccgacagttacctcaaagcggcggatatcgtgctggaagccggacaatcg
ctgaccattaaagcgcccggcgggtttattaagattgacggcgcgggtgtcaccatttcc
ggcacgctggtgaaaattaacgacggtggttccgccggggcgggtacggcgccagtgtcc
atcgaacccgagtcccccaccagaccgacgctgcccgatgcgccggaccggcgttaa

DBGET integrated database retrieval system