KEGG   Dickeya zeae Ech586: Dd586_1292
Entry
Dd586_1292        CDS       T01138                                 

Definition
(GenBank) type VI secretion system lysozyme-related protein
  KO
K11905  type VI secretion system protein
Organism
ddc  Dickeya zeae Ech586
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddc02044]
    Dd586_1292
Secretion system [BR:ddc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dd586_1292
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACZ76174
UniProt: D2BVM0
Position
1440537..1440968
AA seq 143 aa
MPSLSAWERGSAASLFDRIRGEERRSSPETELEDLIASVKRQLDQVLNTRPGSCRSAPEL
GVIDFNDATQGGADIRGKIREAIRQCICRFEPRIVHVDVSASDYLSNPLEMSFQVTAHVR
LEELEQVTSFNIHMDSHRHYRMM
NT seq 432 nt   +upstreamnt  +downstreamnt
atgccgtcgctctctgcctgggagcggggatctgcggccagcctgtttgatcgcatccgg
ggagaggagcgtcgctcctcccccgaaacggaattagaagacttgatcgcgtcggtgaaa
cgccagcttgatcaagtgctgaatacgcgtcccggcagttgtcgcagcgcacctgagctt
ggcgtgattgattttaatgacgctacgcagggcggcgcggatatccggggcaaaatccgt
gaggcgatccggcagtgtatctgtcgctttgaaccgcgcattgtccatgtggacgtcagt
gcatcggactatctgtccaatccgctggagatgtcgtttcaggtcaccgcccatgtgcgg
ctggaagaactggaacaggtcacctccttcaatattcatatggacagccaccgccattac
agaatgatgtga

DBGET integrated database retrieval system