KEGG   Dickeya zeae Ech586: Dd586_1295
Entry
Dd586_1295        CDS       T01138                                 

Definition
(GenBank) FHA domain containing protein
  KO
K11894  type VI secretion system protein ImpI
Organism
ddc  Dickeya zeae Ech586
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddc02044]
    Dd586_1295
Secretion system [BR:ddc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   Dd586_1295
SSDB
Motif
Pfam: FHA Kdo_hydroxy
Other DBs
NCBI-ProteinID: ACZ76177
UniProt: D2BVM3
Position
1443717..1444931
AA seq 404 aa
MNENNPLTLVVLNSEQLDINSQVQHRFDHRGGTLGASEKDQWQLRDRLGAVLPEHARIEL
QDGYFCVCDLSGQTFINGALSPIGRDRRVRLAQGDELVIGPFRLGVYLDDPAFEQDIDQV
LGQRPGDVLEGWLGEEQRRAPADDTAADRFNDPLWALQQEQSRSLLATEAERGDELPTSL
SSFSAVEDTMDQKFVELPTIDNPHTGTAFGASVDAVTLAPLLRGLGVSLNTGDEQQLREM
LEEMGKSLKAMVEGLLTLQADQAALADTHLRPIEDNPLRLGLDYTDTLSLLFADDKSPVH
LSAPAAISEVLSNMQAHHRANQQAIAVALESILQAFSPAALLGRFEHYRRSGERQALDDG
WAWQMYQHYYRELTSPRQQGFQKLFHQVYAQAYDRAVRQQQEQK
NT seq 1215 nt   +upstreamnt  +downstreamnt
gtgaacgaaaacaacccactcactctggtggtgctcaacagcgaacaactggatatcaac
tcgcaggtgcaacaccgctttgaccaccgtggcggcacgctgggcgcatcggaaaaagat
caatggcagttgcgcgaccggctcggcgcagttttgccggagcatgcacgtatcgaatta
caggatggctatttctgcgtctgcgacttgagtggccagaccttcatcaatggcgcgttg
tcgcccatcggtcgtgatcgccgggtgcgtttggcgcagggtgacgaactggtgattggc
ccattccggcttggggtttacctcgacgatcccgctttcgagcaggatatcgatcaggtg
ctggggcaacgccccggtgatgtgctggaagggtggcttggggaagaacaacgccgtgcg
cccgccgatgacacggcggcggaccgatttaatgacccgttgtgggcgctgcagcaggaa
cagagccgctcgctactggcaacggaggctgagcgcggtgatgaactgccgacctcgctt
tcttctttttctgccgttgaggacaccatggatcagaaatttgtggaattaccgaccatt
gacaatccgcataccggtaccgcgtttggcgcatcggtggatgcggtgacgctggcaccg
ctgttgcgcgggctgggcgtatcactcaataccggcgatgagcaacaactgcgcgagatg
ctcgaagagatgggcaaaagcctcaaagcgatggtggaaggcttgctgacgttgcaggcc
gatcaggcagcgctggcggatacccatttgcggccaatcgaagataacccgttgcgtctg
gggctggattacaccgacaccctgtcgctgctgttcgccgacgataaaagcccggtgcac
ctgtccgccccggcggctatcagcgaagtgctgagtaatatgcaggcgcatcaccgggct
aaccagcaggcgatcgccgtggcgctggagagcattttacaggcgttttcaccggcggcg
ctgctggggcgtttcgagcattatcgccgcagcggcgagcgtcaggcgctggatgacggt
tgggcgtggcagatgtatcagcactattaccgcgaactgacctcaccgcgtcagcaaggg
ttccagaaacttttccatcaggtgtatgcacaggcgtatgaccgcgccgttcgtcagcaa
caggagcagaaataa

DBGET integrated database retrieval system