KEGG   Dickeya zeae Ech586: Dd586_1296Help
Entry
Dd586_1296        CDS       T01138                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dd586_1296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddc02044]
    Dd586_1296
Secretion system [BR:ddc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dd586_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: ACZ76178
UniProt: D2BVM4
Position
1444931..1445467
Genome map
AA seq 178 aa AA seqDB search
MLRALMLRTGWLCVLMLLLPGCTTLGKMAKVAANPDIQIGSNDNQPSTVGFSLLAEPDVN
PSESGDAAPIEFQVVMLAEDSRLLATDYDQVTGDIEKALAKNYVSHQDYTLLPGQFKYLP
PVKLDEKVHYIGVIAKYADPDSAEWRKVIKLKNTGRTYQLLVHLRREEVEIKKDQEEE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgagccttaatgctgcgaaccgggtggttatgcgtcctgatgctgctgcttccc
ggttgtaccacgctcggcaaaatggcgaaggtggcggccaatccggacattcagattggc
agcaatgataaccagccttcgaccgtcggctttagcctgctggccgagccggacgttaac
cccagtgagagcggcgacgcggcacccatcgagtttcaggtggtgatgctggcggaagac
tcccgcctgctggcgaccgactatgaccaggtgaccggcgacatcgaaaaagcgctggct
aaaaactacgtcagccaccaggactacacgctgctgccagggcagttcaaatacctgccg
ccggtcaaactggacgagaaagtgcattacatcggggtgattgccaaatacgccgacccg
gacagcgccgagtggcgcaaggttatcaaactgaaaaacaccggccgcacttatcagctt
ctggtgcatctgcgccgtgaagaagtcgaaatcaagaaagatcaagaagaagaataa

DBGET integrated database retrieval system