KEGG   Dickeya zeae Ech586: Dd586_2483Help
Entry
Dd586_2483        CDS       T01138                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00780  Biotin metabolism
ddc01100  Metabolic pathways
Module
ddc_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Dd586_2483
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ddc01007]
    Dd586_2483
Enzymes [BR:ddc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Dd586_2483
Amino acid related enzymes [BR:ddc01007]
 Aminotransferase (transaminase)
  Class II
   Dd586_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_3 OKR_DC_1 SHMT
Motif
Other DBs
NCBI-ProteinID: ACZ77332
UniProt: D2C2G8
Position
complement(2791822..2792976)
Genome map
AA seq 384 aa AA seqDB search
MSWQQRIDQALAQRQAQDAYRVRLANDGGSGRWLVREQQRYLNFSCNDYLGLSQHPAIVR
AWQQGAQQFGVGSGGSGHVTGYTTAHQQLEQQLADWLGYDRAVLMISGFAANQAVITALM
AEGDRILADRLSHASLLEAASLSPATLRRFHHNQPESLQQLLEKPVGGQTLVVTEGVFSM
DGDTAPLAALHQCCHAHRAWLMVDDAHGIGTLGAQGRGCCAQQGVKPELLIVTFGKAFGV
SGAAVLCSQSIAEYLLQFARHLIYSTAMPPAQACALSAALAVIRGDDGEARRDSLAQNVR
RFREGAAGLPFRLLASESAIQPLIVGDNAWSLALSQQLRSAGLWVNAIRPPTVPPGTARL
RITLTASHQPDDINRLLEVLHDAG
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagcaacggatcgatcaggcgctggcacagcggcaggcgcaagacgcttat
cgggtgcgtctggccaatgacggcggcagcggtcgctggctggtgcgcgagcaacaacgc
tatctcaatttttcctgtaatgattatctggggttgagtcagcatccggcgatagtgcgc
gcctggcagcagggggcgcagcagttcggtgtgggcagcggcggctccggccacgtgacc
gggtataccaccgcacaccagcaactggagcaacagttggcggactggctgggatatgac
cgggctgtgctgatgatctccggttttgcggcgaatcaggcggtgataaccgcactgatg
gcagagggcgaccgcattctggcggatcgcctcagccatgcctcgttactggaggccgcc
agcctgtcgcctgcgacgctacgccgctttcaccataatcagccggagtcactgcaacaa
ttgctggaaaaaccggttggcgggcagacgctggtggtcaccgaaggggtattcagcatg
gatggtgatacggcaccgctggcggcattgcaccagtgctgtcacgcacatcgcgcctgg
ctgatggtggatgatgcccacggtatcggcacgctgggggcgcaagggcgcggctgttgc
gctcaacaaggggtgaaacctgagttgctgatcgtcaccttcggcaaagcctttggtgtc
agcggcgcggcggtgctgtgtagtcagtcgattgcagaatacttgctacagtttgcccgc
catctgatatacagcactgccatgccaccggcgcaagcctgtgcgctgtcagcggcgctg
gcagtgattcgcggcgatgatggagaggcccggcgtgattcgctggcgcagaatgtccga
cgttttcgtgagggggctgctggcctgccgtttcgcctgttggcatcagaaagcgccatt
caaccgttgattgtcggtgataatgcctggtcgctggcgctgtcgcagcaattgcgctcc
gcggggctgtgggtcaacgccatacggccgcccaccgtgcctccgggtacggcacgcttg
cgcattaccctgacagccagtcatcagcctgacgacatcaacagactgctggaggtgttg
catgacgcaggttga

DBGET integrated database retrieval system