KEGG   Dickeya zeae Ech586: Dd586_2672Help
Entry
Dd586_2672        CDS       T01138                                 

Definition
(GenBank) P-type conjugative transfer protein VirB9
  KO
K03204  type IV secretion system protein VirB9
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dd586_2672
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddc02044]
    Dd586_2672
Secretion system [BR:ddc02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Dd586_2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX
Motif
Other DBs
NCBI-ProteinID: ACZ77514
UniProt: D2BRW7
Position
3004207..3005112
Genome map
AA seq 301 aa AA seqDB search
MKSITLIPLALMMCGTAWCAAIPQASRYDARVQQVVYNPLNVTVVSTRPGFMTTLVFDSD
EAVISARPGFEEAWEATPDANRVNVRPVALVQGAPGADGNTTQVVIPPNSQDWHTNLLIV
TTRRLYNVELNVIDDKSPQQPAFQVSYRYPGEAQEKASRETAARMREQEQKQQQADIQQA
LNAAQTPRNWDYLKYPGRDSTRIVPDFAYDDGRFTFVGFSPAKSIPSVTKELNGQEHVVN
SSIRRKGNFTVLVIQEVTPRLVLRSGNAVVGLENRGFGKVQAADGATVSPYVERVEKPAT
H
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcatcactcttatcccgctggcgctcatgatgtgtggcacggcatggtgcgcg
gccatcccgcaggccagccgctatgatgcccgcgttcagcaggttgtctataacccactg
aacgttactgtcgtcagcacccggcccggcttcatgaccacgctggtctttgacagcgac
gaagcggttatcagcgccagacccggttttgaagaagcgtgggaagccacaccggacgcc
aaccgggtcaacgtccgcccggtggcgctcgttcagggcgcgcccggcgcggacggtaac
accacgcaggtggtgatcccccctaacagccaggactggcataccaacctgctgatcgtc
accacccgtcggctctacaacgtcgagctgaacgtcatcgatgataagtcaccgcagcag
cccgctttccaggtgagttaccgttatccgggtgaagcacaggaaaaggccagccgtgag
acagcggccagaatgcgggagcaggagcaaaaacagcagcaggctgacattcagcaggcc
ctgaatgccgcacagacgccacgcaactgggactacctcaaatatccggggcgcgacagc
acccgtatcgtgccggatttcgcgtatgacgatggccgctttacgttcgtgggcttctcc
ccggccaaatctattccctccgtgacaaaggagctgaacggccaggagcatgtggttaac
agcagtatccgcagaaaaggcaacttcaccgtattggttattcaggaggtcacgccccgt
ctggtcctgcgttccggtaacgccgtggtcggtctggaaaatcgtggtttcggtaaggtc
caggccgctgatggtgccacggtttcaccgtatgtcgaacgggtggaaaagcccgcaacc
cattga

DBGET integrated database retrieval system