KEGG   Dickeya zeae Ech586: Dd586_2786Help
Entry
Dd586_2786        CDS       T01138                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00480  Glutathione metabolism
ddc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dd586_2786
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ddc02000]
    Dd586_2786
Enzymes [BR:ddc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dd586_2786
Transporters [BR:ddc02000]
 Other transporters
  Pores ion channels [TC:1]
   Dd586_2786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ACZ77626
UniProt: D2BS79
Position
complement(3145326..3145955)
Genome map
AA seq 209 aa AA seqDB search
MVIKLHHLNESRSMRILWLLEEAQLPYELIRYQRNPQTQLAPEELKAIHPLGKSPVVEID
GKVVAESGAIVEYIIRRYATHLAPDEQDASYVDYLQWIHFAESSAMLPVLLKVFNQFEKK
SGQTLHFLDDYADTEFRKVFSYLDDYLASREFIVGQRLTGADFMLGFVVQLVIERFNLGQ
QYPHIARYVTRLADTPGWQRAKHLDSTPA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggtcataaagctacatcatctgaatgaatcgcgttctatgcgtatcctctggttgctt
gaagaggcgcagcttccttatgagttgatccgctatcaacgtaatccgcagacgcaactg
gcaccggaagaactgaaggcgattcatccgctgggcaaatcaccggtggttgagattgat
ggcaaggtggttgccgagtcaggggcgattgttgagtacatcattcgtcgatacgcgaca
catctggcacctgacgaacaggacgcgagctatgtcgactatctgcaatggatccatttt
gcggaaagctccgccatgctgccggtgttactgaaagtctttaaccagtttgagaagaaa
agcggtcagacactgcattttctggatgactatgctgacacggaattcagaaaagtattt
tcttatctggacgactaccttgcttcacgcgagtttattgtcgggcagcgcctgactggg
gcagactttatgctggggttcgtggtgcaattggtcatcgagcggtttaatttggggcag
cagtatccccatattgcccgttatgtgacgcgtcttgccgacacacctggctggcagcgg
gcaaaacatctggattccaccccggcataa

DBGET integrated database retrieval system