KEGG   Dickeya zeae Ech586: Dd586_3693Help
Entry
Dd586_3693        CDS       T01138                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00630  Glyoxylate and dicarboxylate metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
ddc01120  Microbial metabolism in diverse environments
ddc01200  Carbon metabolism
Module
ddc_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ddc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dd586_3693
Enzymes [BR:ddc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Dd586_3693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ACZ78523
UniProt: D2BXE8
Position
complement(4234657..4235964)
Genome map
AA seq 435 aa AA seqDB search
MSTSRTQQIEQLEKEWNTPRWEGITRPYRAEDVVNLRGSVNPACTLAQLGAEKLWKLLNG
KSRKGYVNCLGALTGGQALQQAKAGLEAVYLSGWQVAADANLAASMYPDQSLYPSNSVPA
VVQRINNTFRRADQIQWANGIGLDDPRYTDYFLPIVADAEAGFGGVLNAFELMKSMIEAG
AAAVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVLGVPTLLVARTDADAAD
LLTSDCDDYDRDFVTGERTVEGFYRTRAGVEQAISRGLAYAPYADLVWCETSKPDLEQAR
RFAEAIHARFPGKLLAYNCSPSFNWKKNLDDRTIAHFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAIQQGYTFSSHQQEVGTGYFDKVTTLIQGGV
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctctcgtacccaacaaatagagcaactggaaaaagagtggaataccccgcgc
tgggaaggcatcacccgcccgtatcgcgctgaggacgtggtgaatttgcgtggttcagtg
aaccctgcctgcacactggcgcaactgggagcggaaaaactgtggaagttattgaacggt
aagtcacgtaaaggctacgtcaactgccttggcgccctcaccggcgggcaggcgctgcag
caggcgaaagccgggctggaagcggtgtatctgtccggctggcaggtggcggcagatgcc
aacctggccgccagtatgtacccggaccagtcgctgtatccgtctaactcggtaccggcg
gtggtgcagcgcattaacaataccttccgccgtgcggatcaaatccagtgggctaacggt
atcgggctggatgacccgcgttacaccgactatttcttaccgatcgtggccgatgcggaa
gctggttttggcggggtgttgaatgcgtttgagttgatgaaatcgatgattgaagcaggt
gccgctgccgtccactttgaagatcaactggcgtcggtgaagaagtgcggccatatgggg
ggcaaagtgctggtgccgacgcaggaagcggttcagaagttggtagcagcccgtctggcg
gccgatgtattgggcgtaccgacattgctggtagcacgaactgacgctgatgcggcggat
ttgctgacctcggattgtgatgattacgatcgggattttgttaccggtgaacgtacggta
gagggtttttaccgcacccgcgccggtgtagagcaggctatcagtcgtgggctggcttat
gccccttacgccgatttggtgtggtgtgaaacctctaagccggatctggaacaggcgcgg
cgttttgccgaggcgattcatgcccgctttcccggtaaactgctggcgtataactgctcg
ccgtcattcaactggaagaagaatctggacgatcgcactatcgctcatttccaggatgaa
ctgtcggcgatgggctacaaataccagttcattacgctggcgggtattcacagcatgtgg
ttcaacatgttcgatctggcgcatgcctatgcgcaaggcgaagggatgaaacactatgtg
gagaaagtacagcagccggaatttgcggccattcagcaaggttacaccttctcttctcat
cagcaggaggtggggaccggttactttgacaaagtgactacgctgattcagggaggtgtg
tcgtcggtgacggcgctgaccggatcgacagaagaacaacagttctga

DBGET integrated database retrieval system