KEGG   Dickeya zeae Ech586: Dd586_3811Help
Entry
Dd586_3811        CDS       T01138                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IA, variant 3
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
ddc  Dickeya zeae Ech586
Pathway
ddc00230  Purine metabolism
ddc00240  Pyrimidine metabolism
ddc00760  Nicotinate and nicotinamide metabolism
ddc01100  Metabolic pathways
ddc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dd586_3811
   00240 Pyrimidine metabolism
    Dd586_3811
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Dd586_3811
Enzymes [BR:ddc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Dd586_3811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ACZ78641
UniProt: D2BY49
Position
4344722..4345426
Genome map
AA seq 234 aa AA seqDB search
MNPELNWNEIDTVLLDMDGTLLDLAFDSYFWLQLVPESLSRQREISLDQAQQLIAVEYQA
VRHTLNWYCFDYWSERLGLDIYQMTSDIGHRARLRDDTTPFLHALRKSGRRSVLLTNAHP
HSLSVKVAHTGLDRHLDLLLSTHTYGYPKEDQRLWRAVQEDIGFNPERTLFVDDSEPILD
AARTFGIRYCLGVRNPDSTSQQENRFRQHPSMNNYLAFLPDIHQSIRVGNQECS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgaactgaactggaatgagatcgataccgttttgctggatatggacggtacg
ctgctcgaccttgcgttcgacagctatttctggctgcaattggtaccggaatccctgagt
cgtcagcgtgagatcagcctggatcaggcacagcagttgatcgcggtggaataccaggcg
gtgcgtcataccctgaactggtactgcttcgattactggagtgaacgactggggctggat
atttaccagatgaccagtgacatcggccaccgcgcccgcttgcgggatgacaccacgcca
tttctgcacgcactgcgtaaaagcggtcgtcggtcggttttgctgaccaacgcccacccg
catagcctgtcagtcaaggtggcccataccgggctggataggcaccttgatttattgctt
tccacccatacttatgggtatcccaaggaagatcagcgattatggcgggcggtgcaggaa
gacatcgggtttaacccggaacgaaccctgtttgtggatgacagcgagccaatactggat
gccgccagaaccttcggtatccgctattgtctgggtgtccgcaatcctgactcaaccagc
cagcaggaaaatcgcttccggcaacacccatcgatgaacaactatctggcctttctgccg
gacattcatcagtcgattcgcgtcggcaatcaggagtgttcatga

DBGET integrated database retrieval system