KEGG   Dickeya dadantii 3937: Dda3937_00804Help
Entry
Dda3937_00804     CDS       T01305                                 

Definition
(GenBank) IcmF-related protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dda3937_00804
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddd02044]
    Dda3937_00804
Secretion system [BR:ddd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dda3937_00804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C Wzy_C_2 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADM97690
UniProt: E0SGP1
Position
1589582..1593079
Genome map
AA seq 1165 aa AA seqDB search
MLKIIITFLRQQLPKLKPSWLLLGVVVWVVALVLAWWLGPRLTLGDIRPLQSVWGRVVFT
LVWLWLGFAYSAWRVWRRVQQLRAERREQQIIEQDPLQVYVDSQQTFLDRWLQAFQTQLG
KKALYAMPWYLAIGLSGSGKSSLIHRANPANKLNPKLDAELREVAGGQQVNSWVGESAVI
WDPSGQLLAQPEVGAEPSAGRHARLWQHLLQWLSLNRRRQPLNGLVLTIDLSWLSQASVS
ERKAYAQVMRARLQEIAVNINTRLPLYVALTRLDMLRGFDVVYRSLNREARQAVLGVTFT
PQASHGKGWLEELERFWDDWIANLNNNLPEMLLTQSDRGVRNTLFTFVRQLAGLKDYVTE
VLNETLATGDDRAFLVRGVYVSSVYQQGVPFDAFSQSASRRYQLPEPINAAMRGESNTFF
VQKLFPEVIFPEASLAGENRLHSLYRRRRMSIGITCMVLFGLAMIGSWHHFYRVNEEAGR
NVLTKAQAFIGTNELEGQAGYGYQQLPRLNLIRDATLSFGNYHERTPMLADLGLYQGDKI
GPYVEGSYLQMLNQRFLPAVMQGLLEDLNQAPAGSEQKLTILRVMRMLDDASGRNKTLVE
QFMALRWQKAFPGQGRVQEQLMQHLDYALDHTDWHQSREQKDTVAISTFAPFVDPIAGAQ
RELSKLPMYQRVYQSLVMKATQVLPPDLAIRDEVGPTFDSVFTLRNDKAGTVPRLLTYPG
FSDFYLKQDKTLLDLTALDAWVLGQRERAHLSEADRKEILRQVNDRYITDYINQWQKALA
NIDVQPLESPEQALNILTDITGNDQPFQRVLTTVSDNTRIRKLADDENDTAQGINTRIGR
PFMTINAALSGRGEQGPLVQEVNQKLTDLYHYLDQIVNATDPGQAALKAVQARQGNKFAD
PVFALQQYARSLPAPLDRWVGQLAGESASLVTGLAMSSLNQEWLDKVVTPFNEKLADRYP
FNPSSDKDVPLSEMERFFATGGTLDSFYQTNLKSIMDSGMLEGEGASPLQTELVKQLDRA
TRIRQTLFNAQGSLEIHFVVEPVELTANKRRSVLNLDGQLLEYSHGRRTKTPLVWPNSMR
DGAESKLTLVPDDRERSPRSLSFTGPWAMFRLLTNGQLTQVNDNTFDVRFSLEQGGMTYR
VYTDASHNPFAGGLFSQFKLPDSLY
NT seq 3498 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaataatcattacctttctgcggcaacagctgccgaaactgaaaccgtcctgg
ctgctgctgggggtggtggtatgggtggtggcgctggtgctggcctggtggctgggaccg
cggctgaccctcggcgacatacgtccgctgcaaagcgtgtggggccgcgtggtgttcacg
ctggtctggctgtggctgggctttgcctacagcgcctggcgcgtctggcgccgggtgcag
caattgcgcgcggaacggcgtgaacagcagattatcgagcaggacccgctgcaggtgtac
gtcgacagccagcaaacctttctggatcgctggttgcaggcgtttcagacccaactgggc
aaaaaagcgctgtacgccatgccctggtatctggcgatcggcctgtccggcagcggtaaa
agcagcctgattcatcgcgctaacccggccaacaagctcaacccgaagctggatgcggaa
ttgcgcgaagtggccggcggtcagcaggttaacagctgggtcggcgagtcggcggtgatc
tgggatccaagcggtcaactgttggcccagccggaagtcggcgcggagccgtcggccggc
cgtcatgcccgcctgtggcaacacctgttgcagtggctgagcctcaaccgtcgtcgccag
ccgctgaacgggctggtgctgactatcgacctgtcctggttgtcgcaggccagcgtgtcg
gagcgtaaggcgtatgcgcaggtgatgcgcgcccgtttgcaggaaatcgccgtcaatatc
aatacccgcctgccgctgtacgtggcgctgacccgtctggacatgctgcgcggttttgac
gtggtataccgctcgctgaaccgggaagcgcgtcaggcggtgctgggggtgacgttcacg
ccgcaggccagccacggcaaaggctggctggaggagctggagcgcttttgggacgactgg
atcgccaacctcaacaataacctgccggaaatgctgctcacgcagtcggatcgcggcgtg
cgcaatacgctgttcaccttcgtgcgccaactggccgggttaaaggattacgtgacggaa
gtgctgaacgaaacgctggcgaccggcgacgaccgcgcatttctggtacgcggcgtgtat
gtcagctcggtgtaccagcagggcgtgccgttcgacgccttctcccagtcggcctcccgg
cggtatcagttgccggagccgatcaacgccgccatgcgcggcgagtcgaatacgttcttc
gtgcagaaactgttcccggaggtgattttcccggaagccagtctggcgggggaaaaccgg
ctgcacagcctgtatcgccgtcgccgcatgagcatcggcattacctgcatggtgctgttc
gggctggcgatgatcggcagctggcaccatttctatcgggtaaacgaagaggccggccgt
aacgtgctgaccaaggcgcaggcgttcatcggcaccaacgaactggaagggcaggcgggg
tacggttatcagcaactgccgcgtctgaacctgatccgcgacgccaccctgtcgttcggc
aactaccacgaacgcacgccgatgctggccgaccttgggctgtatcagggcgataagatc
ggcccttacgtggaaggctcttacctgcaaatgctcaaccagcgtttcctgccggcggtg
atgcaggggctgctggaagacctgaatcaggcgccggccggcagcgagcagaaactcact
attttgcgggtgatgcggatgctggacgacgcctccggacgcaacaagacgctggtggag
cagttcatggcgctgcgctggcagaaggcgtttccggggcagggcagggtgcaggaacag
ctgatgcagcatctggattacgcgctggatcatactgactggcaccagtcccgcgagcag
aaggatacggtggcgatctccaccttcgcgccgttcgtcgacccgatcgccggcgcccag
cgcgagctgagcaagttgccgatgtaccagcgcgtctaccagagtctggtgatgaaggcg
acgcaggtgctgccgccggatctggcgattcgcgacgaagtggggccgacgttcgattcg
gtcttcaccctgcgcaacgacaaggcgggcacggtgccgcggctgctgacctatcccggc
ttcagcgatttctacctcaagcaggataaaacgctgctggacctgaccgcgctggatgcc
tgggtgctgggtcagcgtgagcgcgcccacctgagcgaggccgaccgcaaagagatcctg
cgtcaggtgaacgaccgctatatcaccgactacatcaaccagtggcaaaaagcgctggcg
aatatcgacgtccagccgctggaaagcccggaacaggcgctgaacatactgaccgacatt
accggcaacgaccagccgttccagcgggtgctgaccacggtgagcgacaacacccgcatc
cgcaagctggcggatgacgaaaacgacaccgcgcagggcatcaatacccgcatcggtcgc
ccgttcatgaccatcaacgccgcgctgagcgggcggggcgagcaggggccgctggtgcag
gaggtcaaccagaagctgaccgatctctaccactatctggatcagatcgtgaacgccacc
gacccggggcaggcggcgctgaaagcggtgcaggcgcgtcagggcaacaagttcgccgac
ccggtgttcgcgttgcagcagtatgcccgcagcctgccggcgccgttggatcgttgggtc
ggccaactggcgggagaaagcgccagtctggtgaccgggctggcgatgtcgtcgctcaat
caggagtggctggacaaagtggtgacgccgttcaacgagaaactggcggaccgttacccg
ttcaacccgtcttccgacaaggatgtaccgctgtccgagatggaacgcttcttcgcgacc
ggcggtacgctggacagcttctaccagaccaacctcaagtcgatcatggacagcgggatg
ctggagggcgaaggcgcgtcgccgttgcagacggagctggtgaaacagctggatcgcgcc
acccgtatccgccagacgctgttcaatgcgcaaggcagcctggaaatccactttgtggtg
gaaccggtggaactgaccgccaacaagcgccgcagcgtgctgaatcttgacggacagttg
ctggaatacagccacggacgccggaccaaaacgccgctggtgtggccgaacagtatgcgt
gacggcgccgaaagcaagctgacgctggtgccggatgaccgcgaacgctcgccgcgcagc
ctgagcttcaccggcccgtgggcgatgttccgcctgctgaccaacggccagctgacgcag
gtgaacgacaataccttcgacgtgcgtttctcgctggaacaaggcggcatgacctatcgc
gtctataccgacgccagccacaatccgtttgccggtggtctgttcagccagttcaaactg
cctgattctctctattaa

DBGET integrated database retrieval system