KEGG   Dickeya dadantii 3937: Dda3937_00810Help
Entry
Dda3937_00810     CDS       T01305                                 

Definition
(GenBank) ImpJ
  KO
K11893  type VI secretion system protein ImpJ
Organism
ddd  Dickeya dadantii 3937
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddd02044]
    Dda3937_00810
Secretion system [BR:ddd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dda3937_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ADM97684
UniProt: E0SGN5
Position
1581237..1582574
Genome map
AA seq 445 aa AA seqDB search
MSSRNRIIWREGLFIKPQHFQQQQRHTDYALHARLSALSDYFYGLQSLAINEEYLNFGRI
ALVNATGVMPDGTVFNIPGDDALPQPLEITDVALANQKVYLALPLAVNGVSEVGQTGAGI
ATRLQSHRHDVRDLHSEGGDVVSMEVGKVSLRLMLERDDRSAYASLAIANILDKRPDGGL
VLDPNFMPCSISVTAIPSLKRFLGESAGLVAERARSLAQRIAAPGQQGVADVAEFMMLQL
LNRAQPQLSHLARLGTLHPERLHEALVQLCGELMTFTDESRLPPEFAAYRHEHQQSSFEP
LMMALRQALSTVLSPRAVSIQMKAQPYGVRVALVGDAELMAGAEFVLAVRARMPQEHLRK
QLLQQTKIASSDKIRELISLQLPGVPLLPLPVAPRQLPYHAGYSYFQLDRQSPAWKSLVT
SNTLAFHIAGEFPELDMQLWAIRGQ
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccgaaatcggattatttggcgggaagggctgttcatcaagccacagcatttc
cagcaacagcaaagacacacggactacgcgctgcatgcccgtcttagcgcgctcagtgat
tatttttacggcctgcaatcactggcgatcaacgaggaatacctcaacttcgggcgtatc
gcactggtgaacgccaccggcgtgatgccggacggcacggtattcaacattccgggggat
gacgcgctgccgcaaccgctggagatcaccgatgtggcgctggctaaccagaaagtgtat
ctggcgctgccgctggcggtgaacggcgtcagcgaagtggggcagacgggcgccggcatc
gccacccgcctgcagtcgcatcgacacgatgtgcgcgatttgcacagcgaaggcggcgac
gtggtgtcgatggaagtgggcaaggtcagcctgcggctgatgctggagcgtgatgaccgc
agcgcctacgcctcgctggcgatagccaacatcctcgacaagcggccggacggcggtctg
gtgctggaccccaatttcatgccgtgcagcatcagcgtcaccgccattccgagcctgaaa
cgctttctgggcgagtccgccggtctggtggcggaacgcgcccgcagcctggcccagcgt
atcgccgcacccggtcagcaaggggtggcggacgtggcggagttcatgatgctgcaactg
cttaaccgcgctcagccgcagctgtcgcatctggcgcgcctcggtacgttgcacccggag
cggctgcacgaagcgctggtgcaactgtgcggcgaactgatgacctttaccgacgaatcg
cgcctgccgccggagtttgccgcttaccgccacgagcatcagcaatccagcttcgagccg
ctgatgatggcgctgcgtcaggcgctgagcaccgtgctgtcgccgcgcgcggtgtcgatt
cagatgaaggcgcagccttacggcgtgcgggtggcgctggtgggcgacgccgaactgatg
gccggcgccgaatttgtgctggcggtgcgcgcccgtatgccgcaggagcatctgcgcaaa
cagctgttgcagcaaaccaagatcgcttccagcgacaaaatccgcgaactcatcagcctg
caactgcccggcgtgccgctgctgccgttgccggtggcgccgcgtcagctgccgtatcac
gccggctacagctacttccagttggacaggcaaagcccggcctggaaatcgctggtcacc
agcaacacgctggcgttccacatcgccggcgaattcccggaactggacatgcaactgtgg
gctatccgcggccagtag

DBGET integrated database retrieval system