KEGG   Dickeya dadantii 3937: Dda3937_00832
Entry
Dda3937_00832     CDS       T01305                                 

Definition
(GenBank) VgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dda3937_00832
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddd02044]
    Dda3937_00832
Secretion system [BR:ddd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dda3937_00832
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345
Other DBs
NCBI-ProteinID: ADM97660
UniProt: E0SGL1
Position
1555504..1557540
AA seq 678 aa
MANSTGLQFTVKIGALADTTFAVVDFELSEALNQPFALSLSLASSQVDIDFGAVLDQPCE
LMVWYEGALQRRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQTKKPDEI
ITQLLQEAGISDFAFSLRHEHAVREYCVQYRESDLTFINRLAAEEGMFYFHEFEAGKHRV
VFADDAGALAKGPELFFNLATQGLSEGAYVRRFRYAEAVSTAEVELKDYCFKTPAYGLSH
KKTSNELEHQRESYQHFDYPGRFKQDPSGKAFTGYRLDALRADAITGVGESNAAELRPGS
AFTLTEHPNPSFNLAWQVVAVTHSGQQPQALEEESGGEPTTLSNSFEVVKGSTTWRAALP
YKPMVDGPQIATVVGPAGEEIYCDKFGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPLITGRTFHATNPTPYVLPEHKTRTTLRTDTHKGSGF
NELRFEDEATREQIYLHAQKDMDAVINNIHRQSVGLDQHLSVANDQFQRVDRHSHRTIGQ
DDFEQIGQDHHQSIGRHLVQSITQSFKRFIGGGEITRIEGSRQTTLSGSEETLIGAHQRV
LVNTDSYLKAADIVLEAGQSLTIKAPGGFIKIDGAGVTISGTVVKINDGGSAGAGTAPVS
IEPEAPTRPTLPDAPDRR
NT seq 2037 nt   +upstreamnt  +downstreamnt
gtggccaacagtacaggattgcagtttaccgtgaaaatcggcgcattggcggacaccacc
ttcgcggtggtggatttcgaactgagcgaggcgctgaaccagccgtttgcgctgtcgctg
agtctcgccagcagtcaggtcgatatcgatttcggcgcggtgctggaccagccgtgcgag
ctgatggtgtggtacgaaggcgcactgcagcgacgggtcagcggcatcgtcagccgtttt
gctcagggcgacaccggctttcgccgcacccgctatcaggccgaggtgcgcccggcgctg
tggcggctggggctgcgcaccaacgcccgtatcttccagaccaaaaagccggatgagatc
atcacgcaattgttgcaggaagccggtatcagcgactttgctttttcgctgcgccacgag
cacgcggtgcgcgaatactgtgtgcagtaccgcgaaagcgacctgacgttcatcaaccgg
ctggcggcggaagaggggatgttctacttccacgagtttgaggccggcaagcaccgggtg
gtgtttgccgacgacgccggcgcgttagctaaaggccccgagctgttcttcaatctcgcc
acgcaagggttgtcggaaggggcatatgtgcgccgtttccgctacgccgaagcggtaagc
accgccgaggtggaactgaaagattactgtttcaaaaccccggcctacgggctgtcgcac
aagaagaccagtaacgagctggagcaccagcgcgaatcctaccagcacttcgactacccc
ggccgttttaagcaagatccgagcggcaaggcgtttaccggctaccggctggacgcgctg
cgtgcggatgcgataaccggtgtaggggagtccaacgccgccgaactgcggccgggcagc
gcctttaccctgactgaacacccgaacccgtcgttcaacttggcctggcaggtggtggcg
gtgacccacagcggccagcagccgcaggcgctggaagaggaaagcggcggtgagccgacc
acgctcagcaacagctttgaggtggtgaaaggatccaccacctggcgcgcggcgctgccg
tacaagccgatggtggacggcccgcagattgcgacggtggtaggcccggcgggcgaagag
atttactgcgataaatttggccgggtgaagctgcaattcccgtgggaccgctacggcgcc
agcgacgaccagagctcctgctgggtgcgggtcagccagggctgggccggcggccagtac
ggcttaatcgccattccgcgcatcggtcatgaagtggtggtgagctttctggagggcgac
ccggaccagccgctcatcaccggccggacgttccatgccaccaaccccacgccgtatgtg
ctgccggagcacaaaacacgcactacgctgcgtaccgatacccacaaaggcagcggtttc
aacgaacttcgtttcgaagatgaggccacccgggagcagatttacctgcacgcacagaaa
gacatggacgcggtgatcaacaacattcatcgccagagcgtcgggttggatcagcatctg
agtgtggcgaacgaccagtttcagcgggtggatcgccatagccatcgcaccatcgggcag
gatgattttgaacagattgggcaggaccatcatcaatcgattggtcgccatctcgtacag
agcatcactcagtcattcaagcgctttatcggcggcggcgagatcacccgtattgaaggc
agccgccagactacgctgtctggttcggaagagacgctgatcggcgcgcatcagcgggtg
ctggtcaataccgacagctacctcaaggcggcggatatcgtgctggaagccgggcagtcg
ctgactatcaaagcacccggcgggtttatcaaaatcgacggcgccggcgtcaccatctcc
ggcacggtggtgaaaatcaacgacggcggttccgcaggagcgggcacggcgccggtgtcg
atcgagccggaggcccccaccagaccgacgctgccagatgcgccggaccggcgttaa

DBGET integrated database retrieval system