KEGG   Dickeya dadantii 3937: Dda3937_01297Help
Entry
Dda3937_01297     CDS       T01305                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00230  Purine metabolism
ddd00240  Pyrimidine metabolism
ddd01100  Metabolic pathways
ddd03030  DNA replication
ddd03430  Mismatch repair
ddd03440  Homologous recombination
Module
ddd_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dda3937_01297 (holC)
   00240 Pyrimidine metabolism
    Dda3937_01297 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dda3937_01297 (holC)
   03430 Mismatch repair
    Dda3937_01297 (holC)
   03440 Homologous recombination
    Dda3937_01297 (holC)
Enzymes [BR:ddd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Dda3937_01297 (holC)
DNA replication proteins [BR:ddd03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Dda3937_01297 (holC)
DNA repair and recombination proteins [BR:ddd03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Dda3937_01297 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ADM96620
UniProt: E0SIA6
Position
complement(446746..447195)
Genome map
AA seq 149 aa AA seqDB search
MKNATFYLIDHDRPSGELNACEALACSLAAARWRAGQRVLIACEDEQQALRLDEALWQRE
PHEFVPHNLAGEGPRQGAPVELAWPQKRGNAPRDLLISLQPQFADFATAFHEVIDFVPYE
ESLKQLARDRYKAYRSVGFQLTTATPPTH
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcgaccttctatcttattgatcacgaccgccccagcggcgagctgaacgcc
tgcgaagcgctggcctgctccctggcggcggcgcgctggcgtgccggtcagcgagtgttg
atcgcctgcgaggatgagcagcaggcattgaggctggacgaggcgctgtggcaacgcgaa
cctcacgaattcgtgccgcataatctggctggagaagggccgcggcaaggcgcgccggtg
gagctggcctggccgcagaagcgcggcaacgcgccgcgcgacctgttgatcagcctgcag
ccgcagttcgcagattttgccaccgctttccatgaagtgatagacttcgtcccttacgaa
gaatctctgaaacagttggcgcgcgaccgctacaaggcctatcgcagcgtcggcttccaa
ttgaccacggcgacgccgccaactcactga

DBGET integrated database retrieval system