KEGG   Dickeya dadantii 3937: Dda3937_01361Help
Entry
Dda3937_01361     CDS       T01305                                 

Gene name
ilvB
Definition
(GenBank) Acetolactate synthase large subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00290  Valine, leucine and isoleucine biosynthesis
ddd00650  Butanoate metabolism
ddd00660  C5-Branched dibasic acid metabolism
ddd00770  Pantothenate and CoA biosynthesis
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01130  Biosynthesis of antibiotics
ddd01210  2-Oxocarboxylic acid metabolism
ddd01230  Biosynthesis of amino acids
Module
ddd_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ddd_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Dda3937_01361 (ilvB)
   00660 C5-Branched dibasic acid metabolism
    Dda3937_01361 (ilvB)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Dda3937_01361 (ilvB)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Dda3937_01361 (ilvB)
Enzymes [BR:ddd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Dda3937_01361 (ilvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M CO_dh
Motif
Other DBs
NCBI-ProteinID: ADN00072
UniProt: E0SGA4
Position
4149262..4150926
Genome map
AA seq 554 aa AA seqDB search
MRYTGAELIIRLLEQQGITTVSGIPGGAALPLYDALGKSRTIRHVLARHEQGAGFIAQGM
ARASGKAAVCMASSGPGATNLLTAIADAKLDSIPLVCITGQVPSGMIGTDAFQEVDTYGI
SIPVTKHNYLVRDISELPQVINDAFRLAQSGRPGPVWVDIPKDVQTATIELAELPAPAEL
TPAPVVDQDALRAAAAMINQAKRPILYLGGGIISAGAHQQAIELAERAGLPTTMTLMALG
AMPVDHPLSLGMLGMHAARYTNMILQQSDLLIVLGARFDDRAIGKAEEFCPDARVIHIDI
DSAEFGKIRQPHVALHADVAQALDQLLPLVDRQARADWLAQVRALQHDFPFSMPNADDPL
SHYGLIRAVAEQLDDQAIITTDVGQHQMWVAQAYPLRRSRQWLTSGGFGTMGFGVPAAIG
AALAEPQRTVVCFSGDGSLMMNIQEMATAVEENLNVKIVLMNNQSLGLVHQQQDLFYQQN
FVASDYRYQTNFLAIAAGFGFATCDLNAAENPQAALRDALQQPGPALIHAAIDINEKVFP
MVPPGAANIEMIGD
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatacaggagctgagctgatcatccgtctgctggagcagcaaggcatcaccaca
gtgagtggtattccgggcggcgcggcgctgccgctgtacgatgcgttgggaaaaagccgt
accattcgccacgtactcgcccgccatgaacaaggggccggattcatcgcacagggtatg
gcgcgcgccagcggtaaagccgcggtttgcatggcgtccagcggtcccggcgccaccaac
ctgctcaccgccatcgccgacgccaaactcgactccattccattggtgtgcatcaccggc
caggtgccgtccggcatgatcggcaccgatgcctttcaggaagtggatacctacggcatc
tcgattccggtcaccaagcacaactatctggtgcgcgacatcagcgagctgccgcaggtg
atcaatgacgccttccggctggcgcagtccggtcgtcccggtccggtctgggtggacatt
cccaaagacgtacaaacggccaccattgagctggcggaactgcccgcgccggccgagctt
accccggcgccggtagtggatcaggatgccctgcgcgccgccgccgccatgatcaatcag
gccaaacggccgatcctgtatctgggtggcggcattatcagcgccggcgcacatcagcag
gctatcgaactggcggaacgcgccgggctgcctaccaccatgacgctgatggcgctgggc
gccatgccggtggatcacccgctgtcgctcggtatgctcggcatgcatgccgcccgttat
accaatatgatcctgcagcaatcggacctgttgatcgtgctgggcgcccgctttgacgat
cgcgccatcggtaaagcggaagagttctgcccggatgcccgcgtgatccatatcgatatt
gattcggcggagttcggcaagatccgccagccgcacgtggcgctgcacgccgatgtggcg
caggcgctggatcagttgctgccgctggtcgaccgtcaggcgcgcgccgactggctcgcc
caggtgcgcgccctgcaacacgatttcccgttcagcatgcccaacgccgacgatccgctc
agccactatggtttgatccgcgccgtggccgagcaattggacgaccaggccatcattacc
accgatgtgggccagcaccagatgtgggtggcgcaggcgtatccgctgcggcgctcgcgc
cagtggctgacctccggcggcttcggcaccatgggttttggcgtccccgcggctatcggc
gccgcgctggcggaaccgcagcgcaccgtggtctgtttttccggcgacggcagcctgatg
atgaacattcaggaaatggctaccgccgtggaagagaacctgaacgtaaaaatcgtgctg
atgaacaaccagtcgctggggctggtgcaccagcagcaggatctgttctaccagcagaat
tttgtggcctccgactaccgctatcagaccaactttctggcgattgccgccggattcggc
ttcgccacttgcgatctgaacgccgctgaaaacccgcaagccgccctgcgcgacgccctg
caacaacccggcccggcgttaattcacgccgctatcgatatcaacgaaaaagtgttcccg
atggtaccgccgggtgccgccaacattgaaatgattggagattaa

DBGET integrated database retrieval system