KEGG   Dickeya dadantii 3937: Dda3937_01616Help
Entry
Dda3937_01616     CDS       T01305                                 

Gene name
aspS
Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dda3937_01616 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ddd01007]
    Dda3937_01616 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ddd03016]
    Dda3937_01616 (aspS)
   03029 Mitochondrial biogenesis [BR:ddd03029]
    Dda3937_01616 (aspS)
Enzymes [BR:ddd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Dda3937_01616 (aspS)
Amino acid related enzymes [BR:ddd01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Dda3937_01616 (aspS)
Transfer RNA biogenesis [BR:ddd03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dda3937_01616 (aspS)
 Prokaryotic Type
   Other AARSs
    Dda3937_01616 (aspS)
Mitochondrial biogenesis [BR:ddd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Dda3937_01616 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: ADM98342
UniProt: E0SAW1
Position
2268723..2270513
Genome map
AA seq 596 aa AA seqDB search
MRTEYCGLLNSSHVGQEVTLCGWVNRRRDLGGLIFIDMRDREGLVQVFFDPDRQDAFTLA
SELRNEFCIQLTGVVRARPDNQVNKEMATGAVEVLATALTIINRAEPLPLDANQTNSEEA
RLKYRYLDLRRPEMAQRLKTRARITSFVRRFMDSHGFLDIETPMLTKATPEGARDYLVPS
RVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMT
APQVREVMEKLVRELWLEIHGVDLGDFPIMTFAEAMRRFGSDKPDLRNPLELVDVADLLK
DVDFKVFSGPANDPKGRVAAIRVPGGAQLSRKQIDEYAKFIEIYGAKGLAYIKVNEKDNG
LEGIQSPVAKFLNDGILSALLARTAAEDGDILFFGADSAKVVTDALGALRLKLGRDLKIT
NENSWQPLWVIDFPMFEEDGEGGLAAMHHPFTAPRDMSPTELEANPTAAIANAYDMVLNG
YEVGGGSVRIHRGEMQQTVFRILGIDERQQREKFGFLLDALKFGTPPHAGLAFGLDRLVM
LLTGTDNIRDVIAFPKTTAAACLMTEAPSFANPSALEELSIAVVGKGKAAQDAENQ
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgcgtactgaatattgcgggctgttgaattcgtcccatgtgggccaggaagtgacgttg
tgcggctgggttaatcgccgccgcgatctgggtgggttgatttttattgatatgcgtgac
cgcgaaggtctggtgcaggtgttcttcgacccggatcgtcaggatgccttcactctggct
tccgaattgcgcaacgagttctgcatccaactgaccggggtagtgcgcgcccgtccggac
aatcaggtcaacaaagagatggcgaccggcgcagtggaagtgctggcgaccgcgctgacc
atcatcaatcgggccgaaccgctgccgctggatgccaaccaaaccaacagcgaagaagcg
cgtctgaagtaccgttaccttgacctgcgccgtcctgagatggctcagcgcctgaaaacc
cgcgcccgcatcaccagctttgtgcgccgcttcatggacagccacggcttccttgatatc
gaaaccccgatgctgaccaaagccacgccggaaggcgcccgcgactatctggtgccgagc
cgtgtgcacaaaggcaaattttacgcgctgccgcagtcgccgcagttgttcaagcagttg
ctgatgatgtccggttttgaccgttattatcagatcgtcaaatgcttccgcgacgaagac
ctgcgtgccgaccgtcaaccggaatttacccagatcgacgtggaaacctccttcatgacc
gcgccgcaggtgcgtgaagtgatggaaaaactggtgcgcgagctgtggctggaaatccac
ggtgtggatctgggcgacttcccgatcatgacgtttgccgaagctatgcgtcgttttggt
tccgacaaaccggacctgcgtaacccgctggaactggtggacgtggccgacctgctcaaa
gatgtggacttcaaggtcttctccggcccggccaacgatccgaaaggccgcgttgccgcc
attcgcgtaccgggcggcgcacagctgagccgtaaacagattgacgaatacgccaaattt
atcgaaatctacggcgccaaagggttggcttacatcaaggttaatgagaaggataacggt
ctggaaggtatccagagcccagtcgccaagttcctgaacgacggcattctgtcggcattg
ctggcgcgtaccgcggcggaagacggcgacatcctgttcttcggtgccgacagcgccaaa
gtggtgacggacgcgctgggcgcgctgcgcctgaaactgggtcgcgacctgaaaatcacc
aatgaaaacagctggcagccgctgtgggtcatcgacttcccgatgttcgaagaggacggc
gaaggcggcctggccgcgatgcaccacccgttcaccgcgccgcgcgatatgtcgccgaca
gagctggaagccaacccgacggccgctatcgccaacgcttacgacatggtgctgaacggc
tacgaagtcggcggcggttcggtgcgtatccaccgtggcgaaatgcaacagacggtattc
cgcattctcggcattgacgagcggcagcagcgcgaaaaattcggtttcctgctggacgcc
ctgaaattcggcaccccgccgcacgccggtctggctttcggccttgaccgtctggtgatg
ctgttgaccggcaccgacaatatccgcgacgtgatcgcgttcccgaaaaccaccgctgcc
gcctgcctgatgaccgaagcgccgagcttcgccaacccgtcggcactggaggaactctcc
atcgccgtggtcggtaagggcaaagccgcgcaggacgcagagaatcagtaa

DBGET integrated database retrieval system