KEGG   Dickeya dadantii 3937: Dda3937_01716
Entry
Dda3937_01716     CDS       T01305                                 
Name
(GenBank) Type IV secretory pathway, protease TraF
Organism
ddd  Dickeya dadantii 3937
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-ProteinID: ADM97021
UniProt: E0SMS4
Position
867251..867796
AA seq 181 aa
MSMAHHVRWGAPSLWLAGLSLSGLVSLAWAALGDVTPYLVYNPTDSIAPGWYRLQPLRPP
LPPLSVGSVVLVSPPVEAAMLAAQRGYLPARVPLLKPIGAMAPQQVCVTADTVRINGVVV
ARVLRADRLGRPLSAWPSCRRLYPGEVFLLSTTNPASFDSRYFGPVPMASVRGAAQPLLT
R
NT seq 546 nt   +upstreamnt  +downstreamnt
atgagcatggcacatcacgtccggtggggcgcgccttcgctgtggctggcgggcctgtcg
ttatccggcctggtttcactggcctgggcagcgctgggggatgttacgccgtatctggtc
tacaacccgacggacagtatcgccccaggctggtatcgccttcagccgcttcgcccgcca
ttgccaccgctatccgttggcagcgtggtactggtgtcgcctccggttgaggccgcaatg
ctggccgcgcagcgtggctacctgccagcgcgggtgccactgcttaaaccgattggggct
atggcaccccaacaggtgtgtgttaccgccgacacagtgcgcattaatggtgtggttgtg
gctcgtgtgctgcgggccgatcggctggggcgaccgttatcggcttggcctagctgtcgg
cgcctgtatccgggggaggtgttcctgctgagcaccacgaacccagcgtcgtttgacagt
cgttattttggaccggtgcctatggcctctgtgcggggagcggcgcaacccctgctgaca
aggtag

DBGET integrated database retrieval system