KEGG   Dickeya dadantii 3937: Dda3937_01760
Entry
Dda3937_01760     CDS       T01305                                 

Definition
(GenBank) Putative Rhs accessory genetic element
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dda3937_01760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddd02044]
    Dda3937_01760
Secretion system [BR:ddd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dda3937_01760
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C Phage_Mu_Gp45
Other DBs
NCBI-ProteinID: ADM97068
UniProt: E0SAL0
Position
complement(912129..913982)
AA seq 617 aa
MANSTGLQFTVKVGALPDTTFAVVDFELSEALNQPFALSLNLASSLPGIDFGAVLDQPCE
LLVWYEGELQRRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQTQKPDAI
IGTLLEEAGITDFAFALRHEHAVREYCVQYRESDLAFINRLAAEEGLFYFHEFEAGKHRV
VFADDAGALTKGPELFFNLATQGLSEGAYVRRFRYAEAVSTAEVALKDYSFKTPAYGLLH
NKMSSELDHQRETYQHFDYPGRFKQDPSGKAFTGYRLDALRAGAMTGEGESNAAELMPGS
SFTLTEHPNPAFNLAWQVVAVTHSGQQPQALEEESGGEPTTLSNSFEVVKGTTTWRAAMP
YKPMVDGPQIATVVGPAGEEIYCDEFGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPIVTGRTFHATNPSPYPLPASKTRTSLRTSTHKGAGF
NELRFEDQAGQEEVFIHAQKDMNTVVLNNRSTSVNASHTENVGGDQTVVVQHNQTVSVKE
NQVTEIQGEQTVAVTQNRNTTVNDNESLQVKNNIAIQSQSGDILIATAGGFIAIDKDGNI
SITGKGLVLNGTRIDLN
NT seq 1854 nt   +upstreamnt  +downstreamnt
gtggccaacagtaccggattgcagtttaccgtgaaggtcggcgcgttgccggacaccacc
ttcgcggtggtggattttgagctgagcgaggcgctgaaccagccgtttgcgctgtcgctc
aatctggccagcagcctgcccggcatcgatttcggcgcggtgctggaccagccgtgcgag
ctgctggtgtggtacgaaggcgaactgcagcgccgggtcagcggcatcgtcagccgcttt
gcccagggcgacaccggttttcgccgtacccgctaccaggccgaggtgcgcccggcgttg
tggcggctcggtctgcgcaccaacgcccgcatcttccagacccaaaaaccggacgccatt
atcggcaccctgctggaggaggccgggattaccgatttcgcctttgccctgcgccatgaa
cacgcagtccgtgaatactgcgtgcagtaccgcgagagcgacctggcgttcatcaaccgg
ctggcggcggaagaagggctgttctacttccacgagttcgaagccggtaagcaccgggtg
gtgttcgccgatgacgccggtgcgctgaccaaaggcccggaactgttcttcaatctcgcc
acgcagggcttgtcggaaggcgcttacgtgcggcgtttccgctacgccgaggcggtcagt
accgccgaggtggcgctgaaggattacagcttcaaaaccccggcttacgggctgctgcac
aacaaaatgagcagcgagctggaccaccagcgcgaaacctaccagcactttgattatccc
ggccgcttcaagcaggacccgagcggcaaggcgtttaccggctaccggctggacgccctg
cgcgccggtgccatgaccggggagggcgaatccaacgccgccgaactgatgccgggcagc
agctttaccctcaccgagcacccgaacccggcgttcaacctggcctggcaggtggtggcg
gtgacccacagcggccagcagccgcaggcgctggaagaagagagcggcggcgagccgacc
acgctcagcaacagtttcgaagtggtgaaaggcaccaccacctggcgggcggcgatgccg
tacaaaccgatggtggacggcccgcagattgccaccgtggtgggtccggcaggcgaagag
atttactgcgacgaatttggccgtatcaaactgcagttcccgtgggaccgctacggcgcc
agcgacgaccagagctcctgctgggtgcgggtcagtcagggctgggctggcggccagtac
ggattaatcgccattccgcgcatcggtcatgaagtggtggtgagctttctggaaggggac
ccggaccagcccatcgtcaccggtcgcacctttcacgccaccaacccgtcgccgtatccg
ctgccggccagcaagacccgcacctcgctgcgtaccagtacccataaaggggccgggttc
aacgagctgcgctttgaagaccaggccgggcaggaggaggtgtttatccacgcccagaag
gacatgaatacggtggtgctgaacaaccgcagcacgtcggtcaacgccagccacaccgag
aatgtcggcggcgaccagacggtggtggtgcaacacaaccagacggtgtcggtgaaagaa
aatcaggtcaccgagattcagggcgagcagaccgtcgccgtcacccaaaaccgtaacacc
accgtcaacgacaacgagtcgctgcaggtgaaaaacaatatcgccatccagtcccagagc
ggcgacatcctgattgccaccgccggtggcttcatcgccatcgacaaggacggcaacatt
tccattaccggtaaagggttggtgctgaacggcacccgtatcgatttgaactga

DBGET integrated database retrieval system