KEGG   Dickeya dadantii 3937: Dda3937_01761
Entry
Dda3937_01761     CDS       T01305                                 

Gene name
hcpA
Definition
(GenBank) Hcp
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ddd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dda3937_01761 (hcpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ddd02044]
    Dda3937_01761 (hcpA)
Secretion system [BR:ddd02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Dda3937_01761 (hcpA)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ADM97069
UniProt: E0SAL1
Position
complement(914093..914611)
AA seq 172 aa
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVQGHEDEMLVQEFNHVVTVPTDPQSGQPA
GQRVHKPFKFTVALNKAVPLLYNALASGEMLPTVTLKWYRTSVEGKQEHFFTTTLTDATI
VDINNQMPHCQDPSKQDYTQLIEVSLAYRKVDWEHTVAGTSGSDDWRAPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgctatatcagcatcgaagggaaaactcagggcaacatcaccgccggt
gccttcacctccgactccgtcggcaacatctacgtgcagggccacgaagacgagatgctg
gtgcaggaattcaaccacgtcgtgaccgtaccgaccgacccgcagtccggccagcctgcc
ggtcagcgcgtgcacaaaccgttcaagttcaccgtggccctgaacaaggccgtgccgctg
ctgtataacgcgctggcctccggcgaaatgctgccgaccgtgaccctgaagtggtaccgc
acctccgtcgaaggcaagcaggagcatttcttcaccaccaccctgaccgacgccaccatc
gtcgacatcaacaaccagatgccgcactgccaggacccgtccaagcaggactacacccag
ctgattgaagtgtcgctggcctaccgcaaggtggactgggagcacaccgttgccggcacc
tccggctccgacgactggcgcgcgccgatcgaagcgtaa

DBGET integrated database retrieval system