KEGG   Dickeya dadantii 3937: Dda3937_01879Help
Entry
Dda3937_01879     CDS       T01305                                 

Definition
(GenBank) Predicted cell-wall-anchored protein SasA (LPXTG motif)
Organism
ddd  Dickeya dadantii 3937
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysM
Motif
Other DBs
NCBI-ProteinID: ADM99184
UniProt: E0SJL0
Position
3175283..3187930
Genome map
AA seq 4215 aa AA seqDB search
MMTAASTETGSTLIFSGVPVPPEAYAKLWVSTLTPVTGSITRWANPSTTPPDFALANQVV
MASAQAGLLTFRAGITLTSSSTGGAGALIGEIPAGQLAATPVPMSSPLPVNEGTGPVFNS
AEDWDLNIPDLSSLAALFVGTQLAAFIPPRFPLGSTLSANQISLSLSYGGATSNVISTNV
AEKVGVSLLPLNAANLESIEFGFSMDPSDALSLRINVGGLFSFFSVDSLVFYAGVTIPTL
IGRFNNISAIDVTDLLHAVGITGIPQSGCQFDTISGTVDVNTGYYAFTGDARFTGSNWSI
NLGSGLTLIEIDSLGVTLTKSAAVTTSELTTSFVFLGSQFYARAYNSSNGGGWLLTGSLS
PTTPMKIADVASQLLPWAADAVPDITINFLNCQFDTSNNTYMVNVGVVWKLDILPVSIYA
EFMLKSNRVTTQSPAQYSGYVRGTVDINGMVLGVAYVFDPTTTDISFSYKSLTVTYHQDK
VDNVKTYVAVSLNNSNVGDLFSFLLEFASPGRNISLSSPWDVLEKIGLPNLTVKVYLQTK
KIEVDIDLDVDLGFMKLTKFVLIYTRQYGKAKFNLQLSGNFLGQDYGQNGAAPLSWDPLN
EAPPVVPGTGTQTFDLEYLGLGQRLALREIPPATMDGVIAALEKALVPAGNPQQNPATQL
PGLTYDAGSNWLIGTRFTAMSTVQLSVVFNDPNLYGLLIQLSGSRAGSLAGLRFEILYRK
ISDSIGVYHIELTLPDAMRHIEMGEVSITLPIITVDIYTNGNFRIDVGFPPSLTDFSRSG
SVQVFPFIGFGGFYFAVLNGTTSSSVPTITNGTFSPVLELGLALQVGVGKTISLGILSGG
ISITVGGQVQGVLAWFNPTPANLSPERYIHLRGTVAVVGIVYATVDFGIIQASVNLTVYA
SVSLDVESYKAILIEISAGVSVRVSIKIVFIRIHFSFSATITESFTIGNDTATPWLIASG
SGANPQLTDRRAYRSRTRTLRQKPYAKLRSRPARSLQKRGLLLRRSAFGLAASTTTVDLT
AIPLISQALPSDFGFPGAPAFPGTTMNPVLALLLGMETSSDPASGTNQFLNFVTDWVVDS
VGHVHDTVSAALIDEILDALSAEDVASTVFTYPALVNLFTSNNIQFSVAARPTTDPGTEV
PMALMAMIPELSMTTPDFSINFLTDRIPEGDYEQTIQQYFADLAAQFAARETGPTLLADE
LGATPDSMAVIVFRYYFQMLAKGLMQQAKTLLANLSLTLDQNAAAAASLTSIANLFTNNY
TVRAGDTLSSIAALFGTTEAELQAANPDDTLTAPKPGQTVFIPTNTVSYTSQTGDTLAGL
SACFGVSQADLETANPGVNFSNLPAGTVLTIPAMRILHTVIADESGTSIAADFGIALGTL
EAANPTVDFNPLVTGTALLIPLQVTADMVATGNEAAQNVLNPAITLALGDITFTAQSTDS
INSLAAQFGVTVEQLINTNQESLTIINPGQSVPLGNLTTSTRAGDSYNALVNYWYGGVTR
FDPSTLNTANPGLTLTAGQTLSIPSSSAKNVTYTVVSGDTFDKIAAANPGLTLPDLMENN
AAIGVDIGQTVTLPSVTVPTSNSFILLYAATTGDTLTTIAEQFFAPDDLSQQSALQSLQQ
WNGKISTTDLLTVGQIINVPYATTFGSIERQYKVSAAQISASTAMGSASLLAARASLTAP
NVVHQVSATDTLGGIAQAYDLSLEQLTDRIAQVTGLFAAAQNNTIQLAIVAIPGMRLSIL
TDNLASMGMFTDALNMTSRFMMSGLRAPAPQFAGEPAPSATAAYPLYAMIGQEYPLGTVT
TGYDIKIGSSGASWVAVQTGAADMPLLPQEITQITAFQTLSFQPNVLQSIALPQFAYTAD
SQTVGAVNMWKTPDIPVDIVPPGQKVVQPSLWTLPDALISALAASPTGTLLYQPKSGTTQ
PDGSIKSTVLENACYATSISIDIQTVPNAPDGIYMVAGADQAGMQRLLALWEYLTSNNET
ATLYVAYADQDTTNASTSGGTLVSDKVNRTSSFILKTNLSTESHGAPQATLQGTRIRMLN
TGLLDSPLATLEPDSALDFLQLLWECSVVKSGGYYLRYETTDGTLGLPANLFSGGTQATL
QIIVVTDNQVAGSPVAYAYNNIALIGDNVDTGSHNIFFEALTHDVTVTDTLTNIAQRYSP
WVSLTPVSLAELNQTVVGSMVPGTTVSGVSGQVAALATDSFLTLALRAGVTVAAIATEKA
TTTGWLQPGNDLQLSGNPVQIVAIGDTLASISREYDFLDPEALATLNLNMPGLLAAGSVL
TIPGKADYTVQTGDTFGSIARFQGVDLSLIAEANQEAVILAVGQPIVVGGGTLNLTATLP
QGHIGFDVTRTDPQPKDPANETDQAALNTLFNLLGFQIDNTVALNASNEGLPAGPTTEND
DDPWDYQQVMSILAFARVNHALDSAPLPPPSLNPYAGISAGAIADVALFFQDVLGNRTNN
STLATIEQPLGYTDEMVTITAWPSATTAYRFAPPVTGTDNLTVAVSISPTQFLPDSTPLQ
MIGGAPSAEQPTAAAVRASSALATYQTVSYQLQQPDVTGWLSTTLGSIGDAENVGETARI
RLLGAANSAYVFMTGAQNLKVTPVTLGTSGYQNVAALINAPLSATSTGYPASSSDVGQYN
AAARADLLWGQGTRLTIPSNYLVLSGDTPQAIVTASQGAVDLATLADQNATVPVAQDAMV
NTAVRTASVGSADLSLGAIALQIGTLVVDGPGDVPGLVTSNADVALTAGLTLSYSDTTGQ
YSYEIPTGGTFNDAAADFTAQVRSHSGDQTAVVSVLDVAGANEFLDNIWPVGTPLSISSV
VTNTSDTLTTLAKDFGAPAGGTGSLEAQFLAGNAEVPGVWAVHTALFIENITVQIAEGST
LADIAVEGLTSVGSVLSNNPDVPFLNTAVLAIPYMADNSAISASVYGAAGTETMNDVVAK
YPGWSLDGLALYNSDVPGLFAPTEIDLNGKKVTPTVTTTMTMLAAEFELTVSVFMSQIAA
LPGIIASGAAFVAPAMTSVSGDTLKDVAARYNIGTGVLAAACASLPGFLPKGESVTIEGT
TYPTYANDTFGLLTTRINADRQIDNLKPLGVSDVGAVAGGVNVGARTLLAPPVGTAVSAT
VTPAKTKAVLSLGVTLTMSRDPVLLAPAFAGAPHVISARTDIPAQPFAGSGDAGQASLTQ
FGLDFEAAFPGLKIATGPAATQTQGTTQIKKPSLKLAVSANPSSSTGGKTLWVVNFSNQG
VGITYEVNRSSIRYFGVTPLSTVAWNNTVEVPTYSSDKGLSWTGKQQAFRAADPDAWNQE
FLAAIDLLLSPAYAVPGSTDTSVATNIANVIGAKADIAAGMSGIVAPIIGTDTTGLTEAQ
TTLKQQLLTTLSSAYSVQTLVQVDLNVQGSGAGSDPTTAPQLSGKLVAGIVRTPDDSEGA
RAATDPSQPFAPLAAQAQVSQSYLAEIIEYVPNIIRTGLTVSYTGATRSYTTTGSDTVAT
IAAFFAVQAGDLPAGMTLASNDGPLFQGSTAINITPFVVPVPTSGYTVTYTANWMNAGVD
NIINANADRTDFFAAGSTVTVNKTSYTPSTTDTLAAIANRFGGQQVFADSLAEIDAGTLP
GGYTLNRSAPPRGIQNVPQMSIATAKGALSTTGSRITTLFGVKDPSVQKSVVLNLDYQVS
QMEIDIHSVDGIQGYKSSSWLNFIIPIVNGADTDGDVGQVQVPVLLRGYPEPTLVSNQAA
GNATTTSDPIKVIAQWNYGFATQRRYAAQDALTLEVRFNQTSDDMDDRLGYDEAPKYESV
IEVLAAFSAVWPAISADLAQLPDTIGGVSSPAAANAVSALADLATRLQNAWMGLQAMNMR
SGLPEKSFKYLMSTLSRGGNGIVSGITLDRLGQATDFSVDADDFLFTTDASYQTALNAGK
VPTALATEFKGFGFALSGDETIMSRTRSSDNTDWLMFDSEASQSILGQSVQAPQTYRLTL
SGTAPNAVIKVYRQLLWPGLMYVPPASHTDETSNWLNASQAGTRLSFTLGTDKALLSEQL
QFDYAFYRLNLLLLQNASGGTSVSRNANLIAGATINPLFVYNTPVVKFPTRITPLLSHTE
TEPMPGANLTDALSNFFETLVLSQTEALPGTTRQMRIGATYWQSSDGVTDPTKTSLSYRN
PLVLAPLVEFNVDTDWEASGLVGTLSRAMSTNAAAMGITPSAPGKWVLDVLVYSYVEGTD
QPIGILNIQNQIFPA
NT seq 12648 nt NT seq  +upstreamnt  +downstreamnt
gtgatgactgcggcctctacggaaacgggcagcacgttgatcttctccggtgtgccggta
ccgcctgaagcctacgccaagctgtgggtcagcacactcacgccggtcaccgggtcgatc
acccgctgggccaatccgagtaccacaccaccggactttgcactcgccaaccaggtggtg
atggcatcggcacaagcgggtctgttgaccttccgagcgggtatcacgctgacgagttcg
tcgacgggcggtgccggggcgctgattggcgaaattccggcgggccaactcgcagcaacg
ccggttccgatgtcaagcccgctgcccgtgaacgagggcacggggcctgttttcaattcg
gcggaagactgggatctgaatatccctgatttgtcgagtttagccgcactgttcgtcgga
acgcagctagcagcgttcatcccaccccgttttccactcggtagtacactcagcgccaat
cagatttcgctttccttgtcctacggcggcgccacgtccaacgtgatcagcaccaatgtc
gcagagaaagtaggtgtttcattgctgccactcaatgcagccaatctggaaagtattgag
ttcggcttttcaatggatccatctgacgccttgagcttgaggattaatgtcggaggactc
ttcagcttcttcagcgtagattcgcttgttttctatgctggcgtcacaattccaacgctc
attgggcgattcaacaatattagtgctatcgatgtcactgatttgctccatgccgtcgga
ataacagggatcccgcagtccggctgtcaatttgacaccatcagcggtactgtcgatgtg
aacaccggctattatgcgttcaccggtgacgcgcgtttcactggctccaactggtcgatc
aatctgggcagcggcctgaccctcatcgagatcgacagccttggcgtgaccctcaccaaa
tccgccgcagtcactacatcggaactcacgacctccttcgtgttcttgggctcccagttc
tacgctcgcgcttacaacagttcgaacggcgggggatggctgctcaccggctccttgtca
ccgaccaccccgatgaaaatcgccgatgtcgccagccagttgctgccgtgggcggccgat
gccgtgccagacatcacgatcaactttctgaactgccagttcgatactagcaacaacact
tatatggtgaatgtcggcgttgtgtggaagttggatatcctgccggtgtccatctatgcc
gagttcatgctgaaatccaaccgggtcaccacgcaatccccggcccagtattctggctat
gtacggggcactgtcgacatcaacggcatggtactgggtgtcgcctatgtcttcgacccg
acgaccaccgacatcagctttagctacaagagcctgaccgtcacctaccaccaggacaaa
gtagacaacgtcaaaacctatgtcgcggtcagcctcaataacagcaatgtcggcgatctc
ttctcgttcctgctggaattcgcctctcctggacgcaacatctcgctgtcatccccctgg
gacgtgcttgagaagattggcctgcccaatctgaccgtgaaggtctatctccagaccaag
aaaatcgaggtcgacattgacctggatgtcgatcttggctttatgaagctgaccaaattc
gtcctgatctacacacgtcagtacggcaaggcgaagttcaacctgcaactgagtggcaac
ttcctggggcaggattacggccagaacggcgcggccccgctcagttgggatcccctgaat
gaagcaccacccgtcgtaccgggcaccggcacccagacctttgacctcgaatatctgggt
ctgggccagcgccttgctctacgcgaaatcccgcccgccaccatggacggcgttatcgct
gcccttgaaaaagcgctcgttcccgcgggaaatccacagcagaatccggcgacacaactg
cctggcctgacctatgacgcaggctcgaactggctgatcggcacccgcttcacggcaatg
tcgacggtgcaactcagtgtcgtcttcaacgacccgaacctgtacggcctgctgatccag
ctctccggcagccgggccggttcactggcaggcctgcgcttcgaaatcttgtaccgaaag
atttcggatagtatcggtgtctatcacatcgagctgacgctgcccgatgctatgcggcat
atcgaaatgggcgaagtctcgatcacgctgcccatcatcaccgtcgatatctataccaac
ggtaatttccgtatcgatgtcggcttcccgccgagcctgaccgacttttcgcgctcggga
tccgtccaggtcttcccgttcatcgggttcggtggtttctattttgccgtcctcaacgga
accacgtcttccagtgtccccacgatcaccaacggcaccttctcgccggtgctggaactc
ggcctcgcgcttcaggtcggtgtcggcaagacgatttcgctgggcatcctctctggtggc
atcagcatcaccgtcggcggtcaggtgcagggtgtgctcgcctggtttaacccgaccccg
gccaacctctcgccggaacgctatattcatttgcgcggcaccgttgcggtggtgggtatc
gtctatgccaccgtcgatttcggcatcattcaggccagcgtcaacctcacggtttatgcc
tcggtttcgctggatgtagagagctacaaggccattctgatcgagatcagtgcaggcgtt
agtgtccgcgtctctatcaagatcgtcttcatccgtattcatttcagcttctctgcaacg
attactgaatccttcacgatcggcaatgacacggcgacaccgtggctgattgcatcggga
tcaggggcaaatccgcaactgacggatcgccgcgcttaccgttcacgtacgcggactctg
cgccagaaaccttacgccaagctgcgcagccgtcctgcccgcagtctccagaagcgcggt
ctcttgctgcgacgctcggcttttggtctggcagcgtcaacgaccaccgtcgacctgact
gcaatcccattgatctcacaggcgctacccagcgatttcggtttccccggcgctccagcc
ttccccggcaccacgatgaacccggtactggcactgctgctcggcatggaaacatccagt
gatccggcatccggcaccaaccagttcctgaactttgtcacggattgggtggttgattcg
gtcggtcatgtccacgataccgtttctgcggcccttatcgacgagatcctcgatgcactg
tcagctgaagacgtggcatccacggtcttcacctacccagccttggttaacctgttcacc
agcaacaatatccagttctccgtcgccgcccgaccgaccacggatcccggtaccgaagtg
ccaatggcactgatggcgatgatcccggaactgtcgatgacgacaccggatttcagcatc
aacttcctgaccgatcgtatccccgaaggggactacgagcagacaatccagcagtatttc
gctgatctggccgctcaattcgccgcccgcgagaccggcccgaccctgctggccgatgaa
ctgggagcgacaccagactccatggcggtcatcgtattccgctactatttccagatgctt
gccaagggccttatgcagcaggcaaaaacgctgctcgccaacctgtcactcactctggac
cagaacgcggccgctgccgcgtccctgacttcgatcgcgaacctcttcaccaacaactac
accgtgcgggccggcgataccttgtcctcgatcgccgccctgttcgggacaacagaagcc
gagcttcaggcagccaacccggatgatactctgaccgcgccgaaacccggtcaaaccgtc
ttcatcccgaccaacacagtgtcctacaccagccagaccggtgataccctagccggactc
agcgcctgcttcggcgtaagccaggccgaccttgagaccgccaaccccggtgtcaacttc
agcaatctgcccgcaggcacagtgctgacgattccggcaatgcgcattcttcacaccgtg
atagcggatgaaagtggcacgtcgatcgccgctgacttcggcattgctctgggcacgctg
gaagcagccaaccctaccgttgatttcaatccgctggtcacgggcaccgccctgttgatt
ccactccaggtcaccgcagacatggtagcgaccggaaatgaagccgcccagaacgtcctc
aacccggcgatcaccctagccctcggcgacatcaccttcaccgcgcagtccacagacagc
atcaactcgctggcagcccagttcggtgtcacggtcgagcaactgatcaacaccaatcag
gaaagcctgaccattatcaacccgggccagtcagtgccgctgggcaatttgactacctcc
acccgggcgggggacagctacaacgccctcgtcaattactggtacggcggtgtcaccagg
tttgatccctcaacgctcaataccgcgaaccccggcctgaccctgaccgcgggccagacg
ctctccatcccgtcgagttcggctaagaacgtgacctacacagtggtcagcggagacacc
ttcgacaagattgccgccgctaacccgggcctcactctgcccgacctgatggaaaacaac
gccgcaatcggggtcgacatcggtcagaccgtcacactgcccagcgtcacggttccaacc
agcaacagcttcattctgctctatgccgccaccactggcgacacgctcaccactattgct
gagcagttcttcgcaccggatgacctgtcccagcagagcgcgctccagagcttgcagcag
tggaatggtaagatcagcacaactgatctgctgaccgtcggccagatcatcaatgtgcct
tacgctaccacttttggcagtatcgagcgccagtacaaggtgagcgcagctcaaatctct
gccagcacggccatgggctcagcgtctttgctggccgcccgggcatcgctgaccgcgccg
aacgtggttcatcaggtcagcgctactgatacgctgggcggcattgctcaggcctatgac
ctgtcgctggagcaactgaccgatcgcatcgcgcaggtgaccggcctctttgcagcagcg
cagaacaacactattcagctcgcgatcgtcgcgatcccaggcatgcgactttccatactg
accgacaatctcgcctcgatgggtatgttcacggacgcactgaacatgaccagccgcttt
atgatgagcggtcttcgggctccggcaccccagtttgcgggcgaacctgcaccttctgcg
acagcggcctatccgctctacgccatgatcggtcaggaatacccactgggcacggtgacc
accggctacgacatcaagatcggaagctccggtgcgtcttgggtcgctgttcagaccggc
gcggccgacatgccgctgctgccgcaggaaatcacacagatcaccgcgttccagaccctc
agtttccagcccaacgttctccaatcgatcgctttgccacagttcgcgtacaccgcagac
agccagaccgtcggtgccgtcaatatgtggaagacgccggatatcccggtcgacattgtg
ccgcccggccagaaggtcgtgcagccctcactctggacactgccggatgccctgatatcg
gctcttgcggccagtccgacaggcaccctgctctatcagccgaaatccggtaccacccaa
cccgatggcagcatcaagagtaccgttcttgagaatgcgtgctacgcgacctcgatcagc
atcgacatccagaccgtcccgaacgccccggatggcatctacatggtggccggagccgat
caggcgggcatgcagcggctgctggccctctgggaatacctgaccagcaacaacgaaacc
gcgaccctctatgttgcctatgctgaccaggatacgacgaacgcctcgacctcaggcggc
acgctggtctccgacaaggtcaatcgcacgagcagctttattctgaagaccaatctcagt
acggagagccacggtgcaccgcaggccacgctgcaaggcacccgcatccgaatgctcaat
acgggcctgctggactcgccgcttgccactcttgaaccggacagtgcgctcgatttcctc
cagttgctctgggagtgcagtgttgttaaatccggcggctactacctgcgctatgagacc
acggatggcacgcttggcctgccagcaaacctcttctccggcggcactcaggcgaccctc
cagatcatcgtggtgacggacaatcaggtcgcgggaagcccggttgcctacgcgtacaac
aacattgccttgatcggtgacaacgtcgacacgggcagccacaacatcttctttgaagcc
ctgacgcacgacgtcacggtcaccgacaccctgaccaatattgcccagcgctattcgccg
tgggtcagcctcaccccagtttctctggcggaattgaaccagaccgtcgtcggctccatg
gtgcccggcaccacggtctccggcgtttctggtcaggttgccgcgctggcaacagacagc
ttcttgaccctcgccctgcgtgctggtgtgacagttgcggcaatagccaccgagaaggca
accaccacgggttggctccaacctggcaacgaccttcagctctcgggcaacccggtacag
atcgttgctatcggcgacacactagcctctatttcgcgggaatatgacttcctcgatccg
gaagcgctggccacgctcaatctcaacatgccaggcctgctggccgccggttcagtgctc
acgattccgggtaaggccgattatacagttcagactggcgacacgttcggcagcattgcc
cggttccaaggcgtcgatctctccctgatcgccgaggcgaaccaagaggccgtcatactg
gcggttggtcagccaatagtggttggcggcggaacgctcaacctgacggcaaccctgcca
cagggccatatcgggttcgacgtcacccgaacggacccgcagccaaaggatccggccaac
gaaaccgatcaggccgcactgaacacactgttcaacctgctgggcttccagattgacaac
acggtggccctcaacgccagcaatgagggtctgcctgcgggcccgaccaccgagaatgac
gatgacccctgggactaccagcaggttatgtcgattctggccttcgccagggttaaccat
gccctcgacagtgcgcctctgccgcctccgtcactgaacccctatgccgggatatctgcg
ggggccattgcggatgttgccttattcttccaggacgtgctgggtaaccgaaccaataac
tcgacacttgcgaccatcgagcagccgctcggctacaccgatgagatggtgaccatcact
gcgtggccatcggcaacgacggcttaccggtttgctccgccggtcaccggtactgacaat
ctgacggtagcggtctcgatttcgccgacccagttcctgccggacagcacaccgctccag
atgatcggcggagcgcccagcgcagaacagccaacggcggccgccgttcgagccagtagc
gcgctcgccacctatcagaccgtctcctaccaacttcagcagcccgatgtgacgggctgg
ctcagcacaacgctgggcagtattggcgatgccgagaacgtaggtgagaccgcacgcatc
cggctgctcggtgccgcgaattcggcttatgtattcatgacaggtgcgcaaaacctgaag
gtcacgccggtcacgctgggcaccagcggataccaaaacgtggctgccctgataaatgcg
ccgctcagcgcaacatcgacgggctacccggcctcttccagcgatgtcgggcagtacaat
gcggcagcccgagcagacctgctctgggggcaaggtacccgccttacgatccccagcaat
tacctcgtgctgtccggggacacaccgcaggccatcgtgacagcctcgcagggtgccgtc
gatctggctacgctggcagatcagaatgccacagtgcccgttgcgcaggatgcgatggtc
aacacagcggttcgcaccgcttccgtgggatccgctgatctgtcactcggcgcgattgcg
cttcagatcggcacactggtggtcgatgggcccggcgatgtgcccggactcgtcacctcg
aacgccgacgtggctctcactgcgggcctgacgctcagctattccgacaccacgggccag
tacagctatgagatcccgacaggcggcaccttcaatgacgccgcagccgatttcacggcg
caggtccgcagccacagcggcgaccagaccgctgtcgtgtcggtcctcgatgtcgccggt
gccaatgagttcctcgacaacatctggccggtgggaacgcccctcagcatatcgagcgtg
gtgaccaacacgtcagatacattaaccactctggcaaaggacttcggtgcgcccgctggt
ggcaccggctcactcgaagcgcagttcctcgcaggcaacgcggaagtccccggtgtttgg
gctgttcacaccgcgctcttcatcgagaacataacggtgcagatcgccgagggtagcacg
ctggccgatatcgcggtggagggcttaacctcggttgggtctgtactcagcaacaacccc
gatgttccgttcctgaacacggcggttctcgcgatcccctacatggcggacaattccgct
atcagtgccagcgtctacggtgcggcgggtaccgaaaccatgaacgacgtggtagccaag
tacccgggttggagcctcgatggtctggcgctctacaacagcgacgtgcccggcttgttt
gcaccaaccgagatcgatctaaacggcaagaaggtcacgccgaccgtcaccaccacgatg
actatgctggccgccgaattcgagctcaccgtcagcgtcttcatgtcccagatcgcagcg
ctgcctggcatcatcgccagcggtgcggcgtttgtcgccccggctatgacgtcggtcagc
ggtgacacgctcaaggacgtggcagctcggtacaatatcgggaccggcgtgctcgctgcg
gcctgtgcatctctgcccggcttcctgcctaagggtgaaagcgtcacgattgagggcacc
acgtatccgacctatgccaacgacacctttggcctgctgactacccgtatcaatgcagac
cggcagattgacaacctgaagccactcggtgtgtctgatgtcggtgccgtggcaggaggc
gtgaacgtgggggctcgcacgttgctggctccgccggtgggcactgccgtgtctgcgacg
gtgacacctgcgaagaccaaagccgttctcagcctcggcgtcacgctgacaatgagccgc
gatccggtgctgttggcacctgcgtttgccggggccccacatgtgatctctgcccgcacg
gatattccagcacagccctttgcaggttccggagatgcgggccaggcgtcgctgacccag
ttcggcctcgatttcgaggccgccttcccgggccttaagatcgcgacgggcccagccgct
acccaaacgcagggcacgacacagatcaagaaaccgtcgctgaagcttgcggtcagcgcg
aatccgtcatcgtcgacgggcggcaagacgctgtgggtggtgaatttttcgaatcaaggc
gtgggtattacctacgaggtcaaccgatccagtatccggtactttggtgttacgcccctt
tccaccgtcgcctggaacaacaccgtcgaagtacccacctattccagtgataagggactg
agctggactggcaagcagcaggcgttccgtgcggccgacccggatgcatggaaccaagag
ttcctggcagcgatcgacctgctgctctctccagcctacgcggtacccggctccaccgat
acatccgtagcaaccaacatcgccaatgtcattggtgccaaggctgacatcgctgccggg
atgtccggcatcgtggcaccgatcattggcacagacaccactggcctgaccgaagcacaa
accacgctgaagcagcaacttctcactacgctgagttccgcctattcggtgcaaacgctg
gtgcaggtcgacctcaatgtgcagggaagtggtgcgggcagcgacccgactacagcaccg
cagttgtccggcaagctggtcgccgggattgtccggacccccgatgatagtgagggtgcc
cgtgcggcaactgacccgagccagccttttgcaccgctagcagcccaggcgcaggtctcc
cagagctatctggccgagatcatcgagtacgtacccaacatcatcagaaccgggctgacc
gttagctatactggcgcaacccgcagttacacgacgaccggctcggacacggttgcgacg
atcgctgcgttcttcgcggtccaggctggcgatcttcccgcaggcatgacgttggccagc
aacgacggcccgctgttccagggctccacggcgatcaatatcacgccttttgtcgtgcct
gtgcccaccagcggttataccgtcacctatacggcaaactggatgaacgctggggttgac
aatattatcaacgccaacgcagatcgaaccgacttcttcgccgcgggcagcacggtgacc
gttaacaagacgtcctatacccccagtacaacggacacgctagcggcgatcgctaaccgg
ttcggtggccagcaggtcttcgccgacagtctggcggagatcgatgcgggcacgctgccc
ggcggctatacgctgaaccgctcggcaccgccgcgcggcatccagaacgtacctcagatg
agtattgcgacggccaagggcgcgctgtccacgaccggttcgcgtattacgactctgttc
ggggtcaaggatccgtccgttcagaagtcagtggtgctgaacctcgactaccaggtcagc
cagatggaaatcgacattcactccgtcgacggtatccagggctacaagagctcgtcttgg
ctcaacttcatcattcccatcgtcaatggggcagataccgacggtgatgtcggacaggta
caggttccggtgctactgcgcggatatcctgagccaacgctggtctccaaccaggccgcg
ggcaacgccacgaccacgtcggatccgatcaaggtcattgcccaatggaactatgggttc
gcgacccagcgccgctatgccgctcaggatgcgttgacgctggaggtccggtttaaccag
accagtgatgacatggatgatcggctcggatacgacgaagcgccgaagtacgaaagcgtg
attgaggtcctcgcggcgttctcggcggtatggccagccatctctgctgacctggcccaa
cttccggacacgatcgggggtgtttcgagcccagccgcagcgaatgcagtatctgcgctt
gctgatctcgcaacccggcttcagaacgcctggatgggacttcaagccatgaacatgcgt
tccgggcttccggagaagagcttcaagtacctgatgtcaacgttgagccgtggcggaaac
ggcattgtcagcgggattacgctggacaggcttggtcaagctaccgacttcagtgtcgat
gctgatgacttcctgttcacgactgacgccagctaccagacggctctgaatgcgggcaaa
gttccgacagcgctcgcgacggagttcaaaggttttggcttcgcactcagcggtgacgaa
acgatcatgtctcggacccggagcagcgataacacggactggctaatgttcgattcggag
gccagccagtccatcctgggtcagagcgtccaggcgccccagacctacagactgacactg
tccggtacagccccgaacgccgtgatcaaggtctaccgtcagctgttgtggccggggctg
atgtatgtgccgcctgccagccacacggatgaaacatcgaattggctgaatgcatctcag
gcaggtacgcgcttatccttcacactgggcaccgataaggcactcctgtcggagcagttg
cagttcgactacgcattctaccgcttgaacctgctgctgctgcagaacgccagcggtggc
acctctgtgtcacgcaatgccaacctgatagcgggtgctacgatcaacccgctgtttgtc
tacaacacgccagtggtcaaattccctacccggatcacgccgctgctcagccatacagag
acggagccgatgccaggtgcgaacctgacagatgccctcagcaacttcttcgagacgctg
gtgttatcgcagactgaggcgttgcccggcacaacacgccagatgcggatcggagcgacc
tactggcagtcatctgacggtgtaactgatcccacgaagacaagcctcagttaccggaat
cccttggtactggcaccgctcgttgagtttaatgtcgataccgactgggaagcttctggc
ctagtgggaacactgtctagagcgatgagcaccaatgcggcggcaatgggtatcacgcct
agcgcgccgggcaaatgggtgctggacgttctggtctacagctacgttgagggcactgat
caacccataggcattctgaatattcagaaccagatattcccggcctaa

DBGET integrated database retrieval system