KEGG   Dickeya dadantii 3937: Dda3937_04059Help
Entry
Dda3937_04059     CDS       T01305                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00040  Pentose and glucuronate interconversions
ddd00052  Galactose metabolism
ddd00500  Starch and sucrose metabolism
ddd00520  Amino sugar and nucleotide sugar metabolism
ddd01100  Metabolic pathways
ddd01130  Biosynthesis of antibiotics
Module
ddd_M00362  Nucleotide sugar biosynthesis, prokaryotes
ddd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dda3937_04059 (galU)
   00052 Galactose metabolism
    Dda3937_04059 (galU)
   00500 Starch and sucrose metabolism
    Dda3937_04059 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Dda3937_04059 (galU)
Enzymes [BR:ddd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dda3937_04059 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADM98404
UniProt: E0SBD5
Position
2330206..2331117
Genome map
AA seq 303 aa AA seqDB search
MSTVNKKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIILV
THSSKNSIENHFDTSFELEAMLEKRVQRQLLKEVQSICPEHVTIMQVRQGLAKGLGHAVL
CAHPLVGDEPVAVILPDVIIDEYESDLKKDNLSEMLQRFYSTGHSQIMVEPVENVSSYGV
VDCKGVELKPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSEHIWDLLKKTEPGAGNEIQ
LTDAIAMLMEKETVEAYHLKGVSHDCGNKLGYMTAFVEYGLRHDALGEDFTQWLKEAIEE
DAN
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgttaataaaaaagtaaaaaaagcggtcattccagtggctgggttggggacg
cgtatgttgcctgctaccaaggccattcccaaagaaatgctgccgctggtcgataagccg
ttaatccagtatgtggttaatgaatgtattgctgccggtatcaatgaaataattttagtt
acacattcttctaagaattcaatagaaaaccattttgataccagctttgaactggaagcc
atgctggaaaaacgcgttcagcgccagctgctgaaagaagttcagtctatttgtccggag
catgtcactattatgcaggttcgtcaggggctggcgaaaggattggggcacgcggtactt
tgcgctcatcctttggttggcgatgagccggtggcggttattttgccggacgtaattatc
gacgaatatgaatccgatctgaagaaagacaacctcagtgaaatgctgcaacgtttttat
agcacaggccatagccagattatggttgagccggtggaaaatgtcagcagctacggcgtg
gtggattgcaaaggcgtggaattaaaaccgggcgacagcgcgccgatggtcggcgtggtg
gaaaaacccaaggcgtcggaagcgccgtctaatttggcggtagtagggcgttatgtactg
tccgaacatatctgggatctgttgaagaaaacagaaccgggcgccggtaatgaaattcag
ttgaccgatgctatcgctatgctgatggaaaaagaaaccgttgaagcttatcacctgaaa
ggggtaagtcatgactgcggtaataagttgggatacatgaccgcatttgtggaatatggt
cttcgccatgacgctctgggtgaagattttactcagtggctgaaagaggcgatagaagaa
gacgccaattaa

DBGET integrated database retrieval system