KEGG   Oleidesulfovibrio alaskensis: Dde_3282
Entry
Dde_3282          CDS       T00294                                 

Name
(GenBank) Formate C-acetyltransferase
  KO
K20038  choline trimethylamine-lyase [EC:4.3.99.4]
Organism
dde  Oleidesulfovibrio alaskensis
Brite
KEGG Orthology (KO) [BR:dde00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dde_3282
Enzymes [BR:dde01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.4  choline trimethylamine-lyase
     Dde_3282
SSDB
Motif
Pfam: PFL-like Gly_radical MIP-T3
Other DBs
NCBI-ProteinID: ABB40076
UniProt: Q30W70
Structure
Position
complement(3271689..3274229)
AA seq 846 aa
MDLQDFSHKLAEATKNLTPAERASLKKIFEGVSAEVFSQPAPVSAVATGAESGIPDGPTP
RHVKLKENFLKQVPSITVQRAVAITKIAKENPGLPKPLLRAKTFRYCCETAPLVIQDHEL
IVGSPNGAPRAGAFSPEVAWRWLQDELDTIGSRPQDPFYISEEDKKVLREEVFPFWQNKS
VDEFCEGQYREADLWEMSGESFVSDCSYHAVNGGGDSNPGYDVILMKKGMLDIQREAREK
LEQLDYANPEDIDKIYFYKSVIETAEGVMIYARRLSAYAAELAARETDPRRKAELQKISE
VNARVPAHAPSNFWEAIQAVWTVESLLVVEENQTGMSIGRVDQYMYPFYRADIDSGRLTE
YEAFDLAGCMLVKMSEMMWITSEGASKFFAGYQPFVNMCVGGVTREGHDATNDLTYMLMD
AVRHVRIYQPTLATRVHNKSPQKYLKKIVDVIRSGMGFPAVHFDDAHIKMMLAKGVSIED
ARDYCLMGCVEPQKSGRLYQWTSTGYTQWPICIELVLNHGVPLWYGKKVTPDMGDLSQYD
TYEKFEAAVKEQIRWITKNTSVATVISQRAHRELAPKPLMSLMYEGCMESGRDVSAGGAM
YNFGPGVVWSGLATYVDSMAAIKKLVYDDRKYTLAQLNEALKADFAGYDQILADCLAAPK
YGNDDDYADMIAADLVHFTETEHRKYKTLYSVLSHGTLSISNNTPFGQLLGASANGRRAW
MPLSDGISPTQGADYKGPTAIIKSVSKMANDNMNIGMVHNFKLMSGLLDTPEGENGLITL
IRTACMLGNGEMQFNYLDNELLLDAQKHPEKYRDLVVRVAGYSAFFVELCKDVQDEIISR
TMLHGF
NT seq 2541 nt   +upstreamnt  +downstreamnt
gtggatctccaggacttttcacataagctcgcggaagcgacaaagaaccttactccggca
gaacgtgcttcgctgaagaagattttcgagggcgtatccgccgaggtcttcagccagccc
gctcctgtatccgccgtggcaacaggtgcagaatccggcattcccgacgggcctacgccc
cgtcacgtcaagctgaaggaaaacttcctcaagcaggtgcccagcatcaccgttcagcgc
gctgtggccatcaccaaaatcgccaaggaaaaccccggtctgcccaagccgctgctgcgc
gccaagactttccggtattgctgcgaaaccgccccgctggtcattcaggaccatgagctt
atcgtgggttcgcccaacggtgccccgcgtgccggtgcgttttctccggaagtggcatgg
cgctggctgcaggatgagctggacaccatcggctcacgtcctcaggaccccttctacatt
tccgaagaagacaaaaaagtgctgcgggaagaggtgttccccttctggcagaacaagtcc
gtggatgaattctgcgaaggtcagtaccgcgaagccgacctgtgggaaatgtccggcgaa
tctttcgtgtccgactgctcctaccatgcggtgaacggcggcggcgactccaaccccggt
tacgacgtaattctgatgaagaagggtatgcttgatatccagcgtgaagcccgcgaaaag
ctggaacagctggattacgccaaccctgaagacatcgataaaatctacttctacaagtcc
gtcatcgagactgccgaaggcgtgatgatatacgccaggcgtctgtcggcctatgccgcc
gaactggcagcccgggaaaccgacccccgccgcaaagccgaactgcagaagatttccgag
gtcaacgcccgtgtgcccgcacatgcgccttccaacttctgggaagccattcaggccgtg
tggaccgtggaatctctgctggtggttgaagaaaaccagaccggtatgtccatcggccgt
gttgaccagtacatgtaccccttctacagggcagacatcgattccggccgtctgaccgag
tacgaagcttttgatctggccggctgcatgctggtgaagatgtctgaaatgatgtggatc
accagcgaaggtgcttccaagttctttgccgggtaccagccttttgtgaacatgtgcgtg
ggcggcgtgacccgtgaaggccacgatgccaccaacgaccttacctacatgctgatggat
gccgtgcgtcacgtgcgtatctaccagcccacgctggccacccgcgtgcacaacaagtct
ccgcagaagtatctgaagaagattgtggacgttatccgctccggcatgggcttccccgcg
gtgcattttgacgacgcgcacatcaagatgatgctggccaagggcgtgagcattgaagat
gcccgcgactactgcctgatgggttgcgtggaaccgcagaaatcaggccgtctgtaccag
tggacctccaccggctatacccagtggcccatctgcatcgaactggtgctcaaccacggc
gtgccgctgtggtacggcaaaaaggtaacccccgacatgggcgacctgagccagtatgac
acctacgaaaagttcgaagccgccgttaaggaacagatccgctggattaccaaaaacacc
agtgtggccaccgtcatttcgcagcgcgctcacagagagcttgcccccaagccgctcatg
tcgctgatgtatgaaggctgcatggaatcgggccgcgacgtttctgccggcggtgccatg
tacaacttcggccccggcgtggtctggagcggtcttgccacctatgtggactccatggcc
gccattaaaaagctggtctacgacgacagaaagtacaccctcgcgcagctcaacgaggcc
ctgaaggccgactttgccgggtacgatcagattctggccgactgccttgccgcacccaaa
tacggcaacgacgatgattacgccgacatgatcgcagccgatctggtgcacttcaccgaa
accgagcaccgcaagtacaaaactctgtattccgtgctcagccacggtacgctgtccatc
tccaacaacacgcctttcggccagctgctcggcgcctccgccaacggccgcagagcgtgg
atgcctctttccgacggcatcagccccacacagggtgcggactacaagggccccacagcc
atcatcaagtccgtttccaaaatggccaacgacaacatgaacatcggcatggtgcacaac
ttcaagctgatgtccggcctgctggatacccccgaaggtgaaaacggcctgataacgctc
atccgtaccgcctgcatgctgggcaacggtgaaatgcagttcaactatcttgataacgaa
ctgctgctggacgcccagaagcatccggaaaaataccgcgacctcgtggtgcgcgtggcc
ggatacagcgccttcttcgtggagctgtgcaaggacgttcaggacgaaatcatcagccgt
accatgctgcatggtttctaa

DBGET integrated database retrieval system