KEGG   Desulfovibrio alaskensis: Dde_0086
Entry
Dde_0086          CDS       T00294                                 

Definition
(GenBank) 6,7-dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00633  Nitrotoluene degradation
dde01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dde_0086
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     Dde_0086
  1.-  
   1.-.-  
    1.-.-.-  
     Dde_0086
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: ABB36887
UniProt: Q317K9
Position
79628..80284
AA seq 218 aa
MHSYIEALTTRYTTKKFDPDRRLDAETVQAVKDILQLSPSSTNSQPWHFVIAGTDEGRQR
VAKAAHGVYAFNASKICDASHVVVLCTKTDIDTEYTTQVLEQEEQDGRFPSEETKAANRK
GREFFAMLHRNELQDAFHWMEKQTFIALGNLLSGAAHLGIHACPMEGFDHEVLEKELGLT
EKGYKPSVIVALGFSAADDFNAVTPKSRWPQERIITEI
NT seq 657 nt   +upstreamnt  +downstreamnt
atgcatagctatattgaagctcttaccaccagatacaccacaaaaaagtttgatccggac
cgcaggctggacgccgaaaccgtgcaggcggtgaaggatattctgcaactcagtccttct
tcgaccaactctcagccgtggcattttgtcattgccggtacggatgaaggcaggcagcgc
gtggcaaaggcggcacacggggtttacgcatttaacgcatcaaaaatctgcgatgcttct
catgttgtggtgctgtgcacaaaaacggatatcgacacggaatacaccacacaggtgctt
gagcaggaagagcaggacggtcgttttccttctgaagaaacgaaggccgccaacagaaaa
ggccgtgagttttttgccatgctgcaccgtaacgagttgcaggacgcttttcactggatg
gagaagcagacgtttatcgcccttggtaatctgttgtccggtgcggcacatctgggcata
cacgcatgccccatggaaggctttgatcacgaagtgctggaaaaagagctgggattgacg
gagaaagggtacaagccctcggtcattgtggctctggggtttagtgccgctgatgatttc
aatgcggtgacacccaaatcccgctggcctcaggaacggataataaccgaaatatga

DBGET integrated database retrieval system