KEGG   Desulfovibrio alaskensis: Dde_0407
Entry
Dde_0407          CDS       T00294                                 

Definition
(GenBank) transcriptional regulator, DeoR family
Organism
dde  Desulfovibrio alaskensis
SSDB
Motif
Pfam: Sugar-bind HTH_23 HTH_Crp_2 Sigma70_r4 MarR_2 HTH_31 HTH_37 HTH_IclR TrmB HTH_28 KORA HTH_17 HTH_38 HTH_PafC
Other DBs
NCBI-ProteinID: ABB37208
UniProt: Q316D8
Position
401530..402495
AA seq 321 aa
MSGYSHEERELLSRIAWAYHVNGMTQAEVADWLGVSRARVVRLLQVCRDEGFVQIIVNTD
RAVCNELERQLEAAFGLRRAIVIPAPANPRQLNHNLGQAAAHYLSGALRDGNSLGLGWGT
TVAAAASSVPVEPAQGLTVVSMYGGLPYSIVVNPYEIVTTFSRRLKASQTYYIAAPMFAP
SPESCRLLKSQELFRSVYARAIQVDIALIGLGELAVNATNIVLGAITREDFRSLVDAGAV
GEVFGAFVDAAGQPVDHPKNHCFMGPTLEEVRSIPLRIAAAGGPSKTAILRAALVGGFAD
VLVTDETTAGTLLMAETGGES
NT seq 966 nt   +upstreamnt  +downstreamnt
atgtccggatattcgcatgaagaacgcgaactgctgagcaggattgcatgggcgtaccat
gtgaacggcatgacgcaggccgaggtggccgactggctgggcgtgagcagagcacgggtt
gtccggctgctgcaggtctgccgcgacgaggggtttgtccagattatcgtcaatacggac
agagccgtgtgcaatgaactggagcggcagctcgaggctgcattcggtctccggcgggcc
atcgtcattcctgcccctgccaatccgcggcagcttaaccataatctgggacaggcggcg
gcgcattatctttcgggcgctctgcgcgacggtaattcgctggggctgggctggggcacc
accgtggccgctgcggcctcatccgtgccggtggagccggcgcaggggcttaccgtcgtt
tccatgtacggcgggctgccctacagcattgtggtcaatccttatgaaatcgtgacaacg
ttttcgcgcaggctgaaagcctcgcaaacctactatatcgcggcgcccatgtttgcgccc
agtccagagtcctgccggctcctgaaatcacaggaactgttccggtctgtctatgcacgc
gccatacaggttgatatcgccctcatcggtctgggtgaactggcggtgaacgcgaccaac
atcgttctgggcgccatcacccgcgaagacttccgctcgctggtggatgccggtgccgtg
ggcgaagtgttcggtgcgtttgtggatgccgcaggccaaccggtggatcatcccaagaac
cattgtttcatggggcccactctggaagaggtgcgcagcattccgttgcgcattgccgcg
gcgggcggtcccagcaaaacggccatcctcagagctgctctggtgggcggctttgcagat
gtgcttgtgacggacgaaaccacggcagggacgctgcttatggcagaaaccggaggtgaa
tcatga

DBGET integrated database retrieval system