KEGG   Desulfovibrio alaskensis: Dde_1174Help
Entry
Dde_1174          CDS       T00294                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00620  Pyruvate metabolism
dde00630  Glyoxylate and dicarboxylate metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dde00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dde_1174
   00630 Glyoxylate and dicarboxylate metabolism
    Dde_1174
Enzymes [BR:dde01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dde_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABB37975
UniProt: Q313C1
Position
1200789..1202975
Genome map
AA seq 728 aa AA seqDB search
MTTRTQTGGLQVASCLSCLVANEIAPDTGVDPVDFWAGAEALFRDFAPRNKELLELRESM
QQSVDAWHRERAGKPHDAAEYKAFLEKTGYLLPEGEDFTISPENVDPEIAEVAGPQLVVP
ITNARYAVNAANARWGSLYDALYGTDVIAETDGMEKGPDYNPVRGREVMRLATAFLDKAV
PLDGMSHGDVTAYILLRDGRRRVLAARDASGKETGLAAPEQFVGFSGGDAPAVVVLRNNG
LHIELHVDRTHPVGAAHPAGVKDVVLEAAVTTIQDCEDSVSAVDAHDKTRTYQSWLGLIK
GDLEASFVKDGTLRVRTLNPDREYTAPDGSALVLPGRSLMLIRNVGHLMTTDAVLTEDGS
PVPEGILDALMTGYVALHELKGNVRYRNSRTGSVYIVKPKMHGPEEVRFTCDLFSRVEDI
LGLPRHMLKVGIMDEERRTSLNLKECIRAARERVIFINTGFLDRTGDEIHTCMEAGPVVR
KNDMKAERWIAAYEDWNVDVGLACGFSGRAQIGKGMWPKPDSMREMLETKGAHPRAGAGC
AWVPSPAAATLHAMHYHDVNVRDVQTALAARRRACRDDMLVLPLLRSAPDAGAVREELEN
NIQSILGYVVRWIEQGIGCSKVPDIHNVGLMEDRATLRISSQHIANWLHHGVCTREEVMA
VFKKMAAVVDSQNAGHQAYTPMAPDFERSIAFQAACDLVFKGREQPSGYTEPVLHQRRRE
AKTRFGQV
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaagaacacagaccggcggtctgcaggtggcatcgtgcctttcctgccttgtc
gccaatgagatagcgccggatacgggtgtcgaccctgtggatttctgggcgggcgccgaa
gcattgttcagggattttgcgccgcgtaacaaagagctgctggaactgcgcgaaagcatg
cagcagtccgttgacgcgtggcaccgcgaacgtgccggcaagccccacgatgcggcggaa
tacaaggcgtttctggaaaaaacaggctatctgctgcctgaaggggaggattttaccatt
tctcctgagaatgtggacccggaaatagccgaggttgccggaccgcagctggtagtgccc
attaccaacgcccgttatgccgtcaatgcggccaatgcccgttggggcagcctgtatgac
gctctgtacggcaccgacgtgatcgctgaaacggacggcatggaaaaagggccggactac
aatccggtgcggggccgcgaggtaatgcgtcttgcaacggcgtttctggacaaagcagtg
ccgctggacggaatgtcgcatggtgatgtgactgcgtatatcctgcttcgggacggccgg
cgccgtgtgctggcggcccgcgacgcatcggggaaagagacgggactcgccgcgccggag
cagtttgtcggtttttccggcggtgatgcgcctgccgtggttgttctgcgcaataacggc
ctgcatattgagctgcatgtggacagaacgcatcccgtgggggcggcgcatcctgccggt
gtgaaagatgtggtccttgaagcggcagtgactaccattcaggactgcgaagattctgta
agcgccgtggatgcccacgacaagaccagaacgtaccagtcatggctggggctgatcaaa
ggcgatctggaagccagctttgtgaaggacggaacactgcgcgtgcgcacgctcaatccg
gacagggaatatacggcgcctgacggcagcgctcttgtgctgcccggccgcagcctgatg
cttatccgcaacgtggggcatcttatgaccacggatgccgtgctgacggaggacggcagc
cccgtaccggaggggattctggacgctctgatgacaggctatgtggcgctgcacgaactg
aagggcaacgtacgctaccgcaacagccgcacaggcagtgtgtatatcgtcaagcccaag
atgcacggtccggaggaagtccgcttcacctgcgatcttttcagcagggtggaggatatt
ctgggactgccccgtcatatgctcaaggtggggattatggatgaagagcgccgcacgtcg
ctgaatcttaaagagtgcatccgcgcggcccgcgaacgggttatttttatcaataccggc
tttctggatcgtaccggcgacgagattcatacctgcatggaggcggggccggttgtcaga
aagaatgatatgaaggcggagcgctggatagctgcatacgaggactggaacgtggatgtg
gggctggcctgcggtttttcgggcagggcgcagataggcaagggcatgtggcccaagccc
gacagcatgcgcgaaatgctggaaaccaaaggggcgcatccccgcgcgggtgcaggttgc
gcatgggtgccctcgcctgctgcagccacgctgcatgccatgcattatcatgatgtgaac
gtgcgcgatgtccagacagcgctggccgcccgacggcgcgcctgccgtgatgacatgctg
gtgctgccgctgctgcgttcggcacctgatgcaggtgctgtgcgtgaagaactggaaaat
aacatccagagcatactcggatacgtggtgcgctggatcgagcagggaatcggttgttcc
aaggtgcctgatattcacaatgtggggctgatggaagaccgtgccacactgcgtatttcc
agtcagcatatcgccaactggctgcatcacggcgtatgcacgcgggaagaagttatggcc
gtgtttaaaaaaatggccgcagtggtggattcgcagaatgccggacatcaggcgtacacg
cccatggcgcctgattttgaacgcagcatcgcctttcaggcggcgtgtgatctggttttc
aaggggcgcgagcagcccagcggctataccgagccggtgctgcaccagcgcaggcgcgaa
gcaaaaacgcgtttcgggcaggtgtaa

DBGET integrated database retrieval system