KEGG   Desulfovibrio alaskensis: Dde_1250
Entry
Dde_1250          CDS       T00294                                 

Definition
(GenBank) glutamate synthase (NADPH), homotetrameric
  KO
K00266  glutamate synthase (NADPH) small chain [EC:1.4.1.13]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00250  Alanine, aspartate and glutamate metabolism
dde00910  Nitrogen metabolism
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01120  Microbial metabolism in diverse environments
dde01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Dde_1250
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dde_1250
Enzymes [BR:dde01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Dde_1250
SSDB
Motif
Pfam: Fer4_20 Pyr_redox_2 Pyr_redox Pyr_redox_3 NAD_binding_8 NAD_binding_7 AlaDh_PNT_C Thi4 HI0933_like FAD_oxidored FAD_binding_2 Oxidored_nitro GIDA FAD_binding_3 DAO Amino_oxidase
Other DBs
NCBI-ProteinID: ABB38051
UniProt: Q312U5
Position
complement(1263741..1265171)
AA seq 476 aa
MKASKKPVRPRVPMPVQPPEERIRNFDEVATGYTLEMAAEEAARCLQCKKPKCVKGCPVE
VPIPQFIAHLAAGDIDAAYRTLKSTNSLPAVCGRVCPQEVQCEGECILTAKGQPVAIGRL
ERFVADEYMHRDACGLISGKPECPLIDPHKKVACIGSGPASLTAAGYLAARGCKVTVFEA
LHELGGVLVYGIPEFRLPKEKIVAKEVNALRELEVDFVRNRVGGKTFSIGELFAQGYRAV
FIGVGAGLPRFLGIPGENLNGVFSANEYLTRVNLGRAYSFPDYDTPIIRGRRVTVFGGGN
VAMDAARTALRLGADSVHIVYRRTVAEMPARHEEVEHAMEEGVKMQELCAPIAFVPDAEG
CLSGVRLQQMQLGEPDQSGRRRPVPVEGSELLLPTDLAVIAVGTRSNPVLLEAEPELDLN
RWGYISINSDTGETSIPDVFAGGDIVTGAATVILAMGAGRTAAKEIARRLGCQPDD
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaaagcaagtaaaaagcccgtcagacccagagtgcccatgcccgtgcagccgcccgaa
gagcggatacgcaattttgacgaagtagcaacgggttacacgctggaaatggccgcagaa
gaagccgcgcgctgtctgcagtgcaaaaaaccaaaatgtgtcaaaggctgtcctgtggaa
gtgcccattccgcaatttatcgcgcatctggcggcgggcgacatagacgcggcctaccgc
accctgaaaagcaccaacagtctgccggcagtctgcggacgggtgtgcccgcaggaggtg
caatgcgaaggcgaatgcatcctgacagccaaagggcagccggtggccataggccgtctg
gaacggtttgtggcagacgaatacatgcaccgcgatgcctgcgggcttatttccggcaag
ccggaatgcccgctgattgatccgcacaaaaaggttgcctgcatcggcagcggaccggcc
agcctgacagctgccggatatctggcggccagaggctgcaaggtgaccgtgtttgaggct
ctgcacgaactgggcggggtgctggtctacggtattccggaattccgactgcccaaagaa
aaaatagtagccaaagaagtgaatgccctgcgcgaactggaagtggactttgtccgtaac
cgtgtgggcggcaagacattctccataggcgaactgttcgcacaggggtacagggcggtc
ttcatcggcgtaggagccggtcttcccagatttctgggtattcccggtgaaaatctcaac
ggggttttttccgccaatgaatacctcacacgggtcaatctgggacgggcatacagcttt
cccgactatgacacacccatcatccgcggacgccgtgttaccgttttcgggggcggcaac
gtagccatggacgcggcccgtacagctctgcggctgggtgcggattctgtgcacatcgtc
tacaggcgcaccgtggccgaaatgcccgcccgccatgaagaagtggaacacgccatggaa
gaaggcgtgaaaatgcaggagctgtgcgctcccattgcgtttgtgcccgatgcggagggc
tgcctgagtggtgtacgcctgcagcagatgcagctgggagagcctgatcagtccggcagg
cggcgtccggtgccggtggagggaagcgaactgcttctgcccacggatctggccgtcatt
gcggtgggaacccgctccaatccggtactgctggaggccgaaccggagcttgacctgaac
agatggggctacatcagcataaacagcgacacaggcgaaaccagcatacccgacgtgttt
gccggcggcgacatagtcaccggcgcagccaccgtgatactggccatgggcgcaggacgc
acagccgccaaggaaattgcccgcaggctcggttgtcagcccgacgactag

DBGET integrated database retrieval system