KEGG   Desulfovibrio alaskensis: Dde_1970Help
Entry
Dde_1970          CDS       T00294                                 

Definition
(GenBank) LL-diaminopimelate aminotransferase
  KO
K10206  LL-diaminopimelate aminotransferase [EC:2.6.1.83]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00300  Lysine biosynthesis
dde01100  Metabolic pathways
dde01110  Biosynthesis of secondary metabolites
dde01130  Biosynthesis of antibiotics
dde01230  Biosynthesis of amino acids
Module
dde_M00527  Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:dde00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Dde_1970
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dde01007]
    Dde_1970
Enzymes [BR:dde01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.83  LL-diaminopimelate aminotransferase
     Dde_1970
Amino acid related enzymes [BR:dde01007]
 Aminotransferase (transaminase)
  Class I
   Dde_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABB38767
UniProt: Q30ZX9
Position
complement(2013568..2014734)
Genome map
AA seq 388 aa AA seqDB search
MTQFTLADRLATLPPYLFAQIDKVKAEVAARGVDIISLGIGDPDMPTPDFVIEALKKAAE
KPANHQYPSYTGMLAFRQEVANWYKRRYAVELDPKTEVLTLIGSKEGIAHFPTAFVNPGD
LVLVCPPCYPVYAIASRFMGGVVQELPLLEENDFLPDLDAVDEATWEKARCIFVNYPNNP
TAAMAPRSFFEKLIGIARKHNVIVVHDAAYTEMYYNENNRPLSIMEIPGAMDVAIEFNSL
SKPYNMTGWRIAMAVGNASLVAGLGKVKENMDSGAFQAVQEAAIVALRDGDAFLAEIRDI
YRKRRDTVIAALNKIGITCRVPEASLYVWARVPEGYTSSDFVTRVLQETGVVMTPGNGFG
AAGEGYFRISLTVNDERLEEAVSRIASL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtttacactcgctgaccggcttgcgacgcttcctccctatcttttcgcacag
atagacaaggttaaagcggaagttgccgcccggggcgtggatatcatcagccttggcata
ggcgaccccgatatgcccacaccggacttcgtcatcgaagccctgaagaaggcggctgaa
aaaccggcaaatcatcagtacccctcgtataccggtatgctggctttccgtcaggaagtg
gccaactggtacaagcggcggtatgcggtggaacttgacccgaaaaccgaagtgctgacg
cttatcggttccaaggaaggcattgcgcattttcccacagcctttgtcaatccgggggat
ctggtactggtgtgcccgccttgctaccccgtgtacgccattgcttcccgctttatgggt
ggggtggtgcaggaacttccgctgttggaagaaaatgatttcctgcccgatctcgatgcc
gttgatgaagccacatgggaaaaagcccgctgcatttttgtgaactatcccaataacccc
actgcagctatggcaccgcgcagcttttttgaaaagctgatcggcattgccagaaagcat
aatgttattgtggtgcacgatgccgcttacaccgagatgtattacaacgagaacaaccgg
cctctttccattatggaaattcccggtgccatggatgtggccatagagttcaactcgctt
tccaagccctacaacatgacgggctggcgcatcgccatggcagtgggtaatgcctctctg
gtggccggtctgggcaaagtcaaggaaaacatggactcgggcgcttttcaggccgttcag
gaggccgccatcgtggccttgcgcgacggtgacgcttttcttgcagaaatccgtgacatt
taccgcaagcgtcgcgataccgttattgccgcattgaataaaatcggcattacctgccgt
gtgcccgaagcctcactttatgtttgggccagagtgcccgaaggttatacctcttcggac
tttgtgacccgcgtgttgcaggagaccggcgtggtgatgacacccggcaacggttttggt
gcggcaggcgaagggtatttccgtatttctcttacagtcaatgacgagcgacttgaggag
gccgtatcccgaatcgccagcctgtaa

DBGET integrated database retrieval system