KEGG   Desulfovibrio alaskensis: Dde_2077Help
Entry
Dde_2077          CDS       T00294                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dde  Desulfovibrio alaskensis
Brite
Enzymes [BR:dde01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Dde_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_23 Methyltransf_25 CMAS GCD14 Methyltransf_11 RrnaAD Methyltransf_32 SAM_MT TPMT
Motif
Other DBs
NCBI-ProteinID: ABB38874
UniProt: Q30ZM2
Position
complement(2118551..2119192)
Genome map
AA seq 213 aa AA seqDB search
MIDKRRSRERMVREQLTARGITDPAVLAAMRKIPRHLFVQEALQAQAYEDHPLPIGYGQT
ISQPFIVALMSQILRVTPGMRVLEIGTGSGYQAAVLAEMGAEVYTVERIAGLQAHARGLL
RRLGYARIRTKLDDGTMGWPLAAPFDRIIVTAGGPGIPEPLAEQLADPGTMAIPVGASRR
EQELYLMHKNDGALSYENYGKVAFVDLVGNHGW
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattgataaaaggcgcagcagagaacgtatggtgcgcgagcagctaacagcgagggga
ataacagaccccgccgtgctggccgccatgcgcaagatacccagacatctttttgttcag
gaggctctgcaggcgcaggcctatgaggaccatccgcttcccataggctatggtcagacc
atctcgcagccgttcatcgtggcgctgatgtcacagattctgcgagtcactccgggaatg
cgtgtgcttgaaatagggacagggtccggctatcaggcggccgtgctggctgaaatggga
gccgaagtctataccgtggaaagaattgcgggactgcaggcccatgcacgcggcctgctg
cgcaggctgggatacgccagaatacggacaaagctggatgacggcaccatgggctggccg
ctggcagccccttttgacagaatcatcgtcacggccggagggcccggcattcccgagccg
ctggcggaacagctggcagaccccggcaccatggccatacctgtgggcgcttcgcggcgc
gaacaggagctttatttgatgcataagaacgacggcgcattgtcgtatgaaaattatggc
aaggtggcctttgtggaccttgtcggcaaccacgggtggtag

DBGET integrated database retrieval system