KEGG   Desulfovibrio alaskensis: Dde_2142Help
Entry
Dde_2142          CDS       T00294                                 

Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
dde  Desulfovibrio alaskensis
Pathway
dde00970  Aminoacyl-tRNA biosynthesis
Module
dde_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dde00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dde_2142
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dde01007]
    Dde_2142
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dde03016]
    Dde_2142
Enzymes [BR:dde01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     Dde_2142
Amino acid related enzymes [BR:dde01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Dde_2142
Transfer RNA biogenesis [BR:dde03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dde_2142
 Prokaryotic Type
   Other AARSs
    Dde_2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 tRNA-synt_1g Anticodon_1 tRNA-synt_1_2 tRNA-synt_1e tRNA-synt_1f zf-FPG_IleRS
Motif
Other DBs
NCBI-ProteinID: ABB38939
UniProt: Q30ZF7
Position
2188928..2191732
Genome map
AA seq 934 aa AA seqDB search
MSDYKKTLHLPVTKFPMKANLTQKEPEMLKRWEQTDAYRIMYSTGATKEPFVLHDGPPYA
NGNIHLGHALNKIIKDIIIKSRNMQGHPSQYVPGWDCHGLPIEHKVEQQLGEKKKTLPAH
AVRRECRKYATKYLDIQRKEFKRLGVMGQWDNPYLTMTPAYEAATARELVRFMEKGSVVR
SKKPIYWCCSCETALAEAEVEYHDHTSPSIFVRFPMPDARVAEILGTDPASTSIVIWTTT
PWTIPDNMAVAVHPEFEYAVVKNDGQHYVLAAELAASCAETFGWENPQTVRTVTGAALEG
LVARHPIYNRESPVVLADYVTLDSGTGCVHTAPGHGREDYETGLRYGLEIYSPMNDEGRF
LDSVEFFAGLNVFEANPKVIEKLAELGNLLAQAKIKHSYPHCWRCKQPVIFRATTQWFIS
MEANGLREKALKAIRNDVDWIPAWGEERIYSMVENRPDWCISRQRLWGVPIIALLCESCD
EAWYDTEWAAGIVEKFANHPTGCDYWFETDLSQIVPEGLVCPKCGGTHWAKVKDILDVWF
DSGTSFAAVVEQREECSFPADMYLEGSDQHRGWFHSSLLASVGTRGIPPYKAVLTHGYVV
DGEGRKMSKSIGNGIAPQEIIDKYGAEILRMWVSSADYREDVRISEEILSRLVDAYRRIR
NTCRYLLGNLSDLSAADLLPVGQLESLDRFALDIAMRAHKRVQAAYNDYEFHKVYHTLHN
LCVSDLSAFYLDILKDRLYSSKADSKERRSAQTAVYHILMLLIRDMAPVLSFTAEEVYSY
IPEALRPEAVTVFALREDDIPPMEMPAAEREDWEAFLAVRAEVTKAMEPVRKSGEIGHPL
DAHVTLFMDDALAAKLKATGADLRACFIVSKVTVAPLAQAPEQAYTSEELNGLRISIAKA
PGQKCERCWIWSEELGSSSEHPSLCPRCTGVLCA
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattataaaaaaaccctgcatctgcctgtcaccaaatttcccatgaaggcaaat
ctgacccagaaagagcctgaaatgctcaagcgctgggaacaaaccgatgcgtaccggatc
atgtactccaccggagccaccaaggagccgttcgtgctccatgacggcccgccctacgcc
aacggcaacatccatctgggacatgcgctcaataaaatcatcaaagatatcattataaaa
tcccgcaacatgcaggggcacccttctcagtatgttcccgggtgggactgccatggtctg
cccatcgaacataaggtggagcagcagctgggcgaaaaaaagaaaacgcttccggcccat
gcagtgcgcagagaatgccggaaatacgccaccaaatatcttgatatccagcgcaaagaa
tttaaaaggctcggcgtgatgggtcagtgggacaacccctatctgaccatgactccggct
tacgaggcagccaccgcgcgcgaacttgtgcgctttatggaaaaaggttcggtggtgcgc
agcaaaaaacccatttactggtgctgctcctgcgaaacggccctcgcggaagccgaggtt
gaataccacgaccacacctcgccttcgatctttgtccgtttccccatgcctgacgcccgt
gtggccgaaattctgggtaccgacccggcatcaacatccattgtcatctggaccactacc
ccgtggacaattccggacaacatggccgtggccgtacaccccgaatttgaatacgccgtg
gtaaagaacgacggacagcactatgtgctggctgctgagcttgccgcttcctgtgcggaa
acctttggctgggaaaacccgcagacagtgcgcaccgtaaccggtgcggcgctggaaggg
ctggttgcccgccaccccatttacaatcgtgaatctcccgtggtgcttgcagattatgta
acgcttgattccggtacaggctgtgtgcacacggcacccggtcacggccgcgaagactac
gaaaccggcttgcgctacggtctggaaatatactcgcccatgaacgacgaagggcgtttt
cttgattccgtagaatttttcgccggactcaatgtctttgaggccaatcccaaagtcatt
gaaaaacttgcggaactgggcaacctgcttgctcaggcaaaaatcaagcattcgtatcct
cactgctggcgctgtaagcagcctgtcatcttccgcgccaccacccagtggttcatttcc
atggaagccaacggcctgcgcgaaaaagcgctgaaagccatccgcaacgatgtggactgg
attccggcatggggcgaagagcgcatctacagcatggtcgaaaacaggcccgactggtgc
atttcgcgtcagcggctgtggggtgtgcccatcatagccctgctgtgcgaatcctgcgat
gaggcatggtacgacacagagtgggcggccggcattgttgaaaaatttgccaatcacccc
acgggctgcgattactggtttgaaacagatctttcgcagattgtacccgaaggacttgtc
tgccccaaatgcggcggtacacactgggcaaaagtcaaagacatccttgatgtctggttt
gactccggcaccagctttgcagccgttgtggaacaacgcgaagaatgctcattccctgca
gacatgtatctggaaggctcagaccagcaccggggctggttccacagctcgctgctggca
tccgtgggcacccgcggtattcctccttacaaagccgtcctaacgcacggctacgttgtg
gacggtgaaggccgcaagatgtcgaaatccatcggcaacggcattgcccctcaggaaatc
attgataagtacggggcagagatactgcgtatgtgggtatcgtccgccgattaccgcgaa
gatgtacggatatccgaagaaatcctgagcagactggtggatgcctaccgcagaatccgc
aatacctgccgctatctgctgggcaacctttcggacctgagcgctgcagacctgctgcct
gtgggccagctggagagccttgaccgctttgcgctggatatagccatgcgtgcccacaaa
cgggtgcaggcagcctataacgactacgaattccataaggtgtaccatacgctgcacaat
ctctgcgtcagcgacctttcggctttctaccttgatatactcaaggaccggctttactca
tccaaagccgactcgaaagaacgccgctcggcacagaccgcagtgtaccacattctcatg
ctgctcatccgcgacatggcaccggtgctcagcttcaccgccgaagaagtgtacagctac
attcccgaagcactgcgtcccgaagccgtgacagtgtttgcactgcgcgaagacgacatt
ccgcccatggaaatgcccgcggcggaacgtgaagactgggaagcttttctggctgtccgc
gccgaagtgactaaagccatggaaccggtccgcaaatccggcgaaattggccatccgctg
gatgcccacgtgaccctgttcatggatgatgcgcttgcggcaaaactgaaggcgaccggt
gcggacctgcgggcctgcttcatcgtttctaaagttaccgtcgcacctctggcacaggct
cctgagcaggcctacacgtcggaagaactgaacggcctgcgcatatccattgccaaggca
cccggacaaaaatgcgaacggtgctggatatggagcgaagaactgggcagcagcagcgaa
cacccgtcgttgtgcccccggtgcaccggcgtactctgcgcctga

DBGET integrated database retrieval system